Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BJR96_RS05240 | Genome accession | NZ_LT545678 |
| Coordinates | 1008730..1008918 (+) | Length | 62 a.a. |
| NCBI ID | WP_070005698.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae isolate SA111 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 985593..1039504 | 1008730..1008918 | within | 0 |
Gene organization within MGE regions
Location: 985593..1039504
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BJR96_RS05130 (SA111_01018) | - | 985593..986681 (-) | 1089 | WP_017646500.1 | site-specific integrase | - |
| BJR96_RS05135 (SA111_01019) | - | 986798..987250 (-) | 453 | WP_017646499.1 | OB-fold protein | - |
| BJR96_RS05140 (SA111_01020) | - | 987475..988230 (-) | 756 | WP_070005695.1 | XRE family transcriptional regulator | - |
| BJR96_RS12465 (SA111_01021) | - | 988395..988523 (+) | 129 | WP_269457098.1 | hypothetical protein | - |
| BJR96_RS05145 (SA111_01022) | - | 988548..989732 (+) | 1185 | WP_000461335.1 | phage major capsid protein | - |
| BJR96_RS12470 | - | 989746..989874 (+) | 129 | WP_001118389.1 | hypothetical protein | - |
| BJR96_RS05150 (SA111_01023) | - | 989877..990179 (+) | 303 | WP_069990145.1 | head-tail connector protein | - |
| BJR96_RS05155 (SA111_01024) | - | 990176..990523 (+) | 348 | WP_000632970.1 | phage head closure protein | - |
| BJR96_RS05160 (SA111_01025) | - | 990520..990897 (+) | 378 | WP_000160226.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BJR96_RS05165 (SA111_01026) | - | 990894..991319 (+) | 426 | WP_069990143.1 | hypothetical protein | - |
| BJR96_RS05170 (SA111_01027) | - | 991335..991928 (+) | 594 | WP_069990141.1 | major tail protein | - |
| BJR96_RS05175 (SA111_01028) | gpG | 991980..992300 (+) | 321 | WP_000273027.1 | phage tail assembly chaperone G | - |
| BJR96_RS05180 (SA111_01029) | - | 992510..996508 (+) | 3999 | WP_069990139.1 | phage tail tape measure protein | - |
| BJR96_RS05185 (SA111_01030) | - | 996505..998028 (+) | 1524 | WP_070005696.1 | distal tail protein Dit | - |
| BJR96_RS05190 | - | 998019..1001843 (+) | 3825 | WP_070005697.1 | glucosaminidase domain-containing protein | - |
| BJR96_RS05195 (SA111_01032) | - | 1001844..1003835 (+) | 1992 | WP_070001270.1 | DUF859 family phage minor structural protein | - |
| BJR96_RS05200 (SA111_01033) | - | 1003850..1004239 (+) | 390 | WP_070002982.1 | DUF1366 domain-containing protein | - |
| BJR96_RS12475 | - | 1004262..1004390 (+) | 129 | WP_000973385.1 | hypothetical protein | - |
| BJR96_RS05205 (SA111_01035) | - | 1004399..1004701 (+) | 303 | WP_001018078.1 | hypothetical protein | - |
| BJR96_RS05210 (SA111_01036) | - | 1004694..1004921 (+) | 228 | WP_000609114.1 | phage holin | - |
| BJR96_RS05215 (SA111_01038) | - | 1005049..1006392 (+) | 1344 | WP_069987850.1 | GH25 family lysozyme | - |
| BJR96_RS05220 (SA111_01039) | - | 1006758..1007270 (+) | 513 | WP_000634506.1 | PBECR4 domain-containing protein | - |
| BJR96_RS11915 (SA111_01040) | - | 1007430..1007629 (+) | 200 | Protein_966 | CsbD family protein | - |
| BJR96_RS05230 (SA111_01041) | - | 1007710..1007961 (-) | 252 | WP_000455663.1 | hypothetical protein | - |
| BJR96_RS12125 (SA111_01042) | - | 1008102..1008248 (-) | 147 | WP_171898157.1 | hypothetical protein | - |
| BJR96_RS05235 (SA111_01043) | - | 1008398..1008607 (+) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| BJR96_RS05240 (SA111_01044) | prx | 1008730..1008918 (+) | 189 | WP_070005698.1 | Paratox | Regulator |
| BJR96_RS05250 (SA111_01046) | - | 1009504..1010115 (+) | 612 | WP_001056394.1 | TVP38/TMEM64 family protein | - |
| BJR96_RS05255 (SA111_01047) | - | 1010247..1011848 (+) | 1602 | WP_231909366.1 | IS1182-like element IS1563 family transposase | - |
| BJR96_RS05265 (SA111_01049) | - | 1012523..1013206 (-) | 684 | WP_000192685.1 | ABC transporter ATP-binding protein | - |
| BJR96_RS05270 (SA111_01050) | - | 1013207..1013575 (-) | 369 | WP_000312256.1 | GntR family transcriptional regulator | - |
| BJR96_RS05275 (SA111_01051) | - | 1013720..1016824 (+) | 3105 | WP_069986596.1 | DNA polymerase III subunit alpha | - |
| BJR96_RS05280 (SA111_01052) | pfkA | 1016905..1017927 (+) | 1023 | WP_000820831.1 | 6-phosphofructokinase | - |
| BJR96_RS05285 (SA111_01053) | pyk | 1017976..1019478 (+) | 1503 | WP_001042784.1 | pyruvate kinase | - |
| BJR96_RS05290 (SA111_01054) | lepB | 1019649..1020206 (+) | 558 | WP_000240773.1 | signal peptidase I | - |
| BJR96_RS05295 (SA111_01055) | glmS | 1020464..1022278 (+) | 1815 | WP_000334317.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| BJR96_RS05300 (SA111_01056) | - | 1022440..1022769 (+) | 330 | WP_000056782.1 | zinc ribbon domain-containing protein YjdM | - |
| BJR96_RS05305 (SA111_01057) | - | 1022904..1023545 (+) | 642 | WP_000120401.1 | amino acid ABC transporter permease | - |
| BJR96_RS05310 (SA111_01058) | - | 1023556..1024185 (+) | 630 | WP_000891269.1 | amino acid ABC transporter ATP-binding protein | - |
| BJR96_RS05315 (SA111_01059) | - | 1024199..1025032 (+) | 834 | WP_000955379.1 | amino acid ABC transporter substrate-binding protein | - |
| BJR96_RS05320 (SA111_01060) | rpsT | 1025117..1025365 (-) | 249 | WP_001872296.1 | 30S ribosomal protein S20 | - |
| BJR96_RS05325 (SA111_01061) | coaA | 1025419..1026339 (-) | 921 | WP_001058331.1 | type I pantothenate kinase | - |
| BJR96_RS05330 (SA111_01062) | - | 1026445..1027035 (+) | 591 | WP_000002661.1 | class I SAM-dependent methyltransferase | - |
| BJR96_RS05335 (SA111_01063) | - | 1027361..1027750 (+) | 390 | WP_000427669.1 | cytidine deaminase | - |
| BJR96_RS05340 (SA111_01064) | - | 1027815..1028864 (+) | 1050 | WP_069986595.1 | BMP family lipoprotein | - |
| BJR96_RS05345 (SA111_01065) | - | 1029009..1030544 (+) | 1536 | WP_000193235.1 | ABC transporter ATP-binding protein | - |
| BJR96_RS05350 (SA111_01066) | - | 1030537..1031598 (+) | 1062 | WP_017650114.1 | ABC transporter permease | - |
| BJR96_RS05355 (SA111_01067) | - | 1031600..1032556 (+) | 957 | WP_000060306.1 | ABC transporter permease | - |
| BJR96_RS05360 (SA111_01068) | - | 1032685..1034145 (+) | 1461 | WP_070005699.1 | IS1182-like element IS1563 family transposase | - |
| BJR96_RS05365 (SA111_01069) | nox | 1034326..1035696 (+) | 1371 | WP_000036813.1 | H2O-forming NADH oxidase | - |
| BJR96_RS05370 (SA111_01070) | - | 1035817..1036806 (-) | 990 | WP_000127487.1 | L-lactate dehydrogenase | - |
| BJR96_RS05375 (SA111_01071) | gyrA | 1037045..1039504 (+) | 2460 | WP_069986710.1 | DNA gyrase subunit A | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7305.39 Da Isoelectric Point: 4.2340
>NTDB_id=1143703 BJR96_RS05240 WP_070005698.1 1008730..1008918(+) (prx) [Streptococcus agalactiae isolate SA111]
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVVDVLEELDYIK
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVVDVLEELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1143703 BJR96_RS05240 WP_070005698.1 1008730..1008918(+) (prx) [Streptococcus agalactiae isolate SA111]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGTCGATG
TGCTGGAAGAATTAGACTATATTAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGTCGATG
TGCTGGAAGAATTAGACTATATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.581 |
100 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
72.881 |
95.161 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
93.548 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
93.548 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
69.355 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
69.355 |
0.516 |