Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | BJR96_RS03695 | Genome accession | NZ_LT545678 |
| Coordinates | 661448..661627 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965647.1 | Uniprot ID | A0A837L314 |
| Organism | Streptococcus agalactiae isolate SA111 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 619458..679586 | 661448..661627 | within | 0 |
Gene organization within MGE regions
Location: 619458..679586
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BJR96_RS03405 (SA111_00668) | - | 619458..619901 (+) | 444 | WP_001162136.1 | flavodoxin | - |
| BJR96_RS03410 (SA111_00669) | - | 619978..620253 (+) | 276 | WP_000418127.1 | chorismate mutase | - |
| BJR96_RS03415 (SA111_00670) | - | 620246..621442 (+) | 1197 | WP_069986161.1 | voltage-gated chloride channel family protein | - |
| BJR96_RS03420 (SA111_00671) | tnpA | 621645..622118 (+) | 474 | WP_070001343.1 | IS200/IS605 family transposase | - |
| BJR96_RS03425 (SA111_00672) | rplS | 622773..623120 (+) | 348 | WP_001068667.1 | 50S ribosomal protein L19 | - |
| BJR96_RS03435 (SA111_00674) | - | 623345..624424 (-) | 1080 | WP_000264734.1 | tyrosine-type recombinase/integrase | - |
| BJR96_RS03440 (SA111_00675) | - | 624547..624750 (-) | 204 | WP_000505363.1 | hypothetical protein | - |
| BJR96_RS03445 (SA111_00676) | - | 624853..625410 (-) | 558 | WP_000891067.1 | GTP pyrophosphokinase | - |
| BJR96_RS03450 (SA111_00677) | - | 625412..626164 (-) | 753 | WP_069986678.1 | XRE family transcriptional regulator | - |
| BJR96_RS03455 (SA111_00678) | - | 626329..626532 (+) | 204 | WP_000658998.1 | hypothetical protein | - |
| BJR96_RS03460 (SA111_00679) | - | 626516..626875 (-) | 360 | WP_000359716.1 | hypothetical protein | - |
| BJR96_RS03465 (SA111_00680) | - | 626948..627136 (+) | 189 | WP_001166512.1 | helix-turn-helix transcriptional regulator | - |
| BJR96_RS03470 (SA111_00681) | - | 627184..627933 (+) | 750 | WP_069986680.1 | phage antirepressor KilAC domain-containing protein | - |
| BJR96_RS03475 (SA111_00682) | - | 627945..628277 (+) | 333 | WP_000158652.1 | hypothetical protein | - |
| BJR96_RS03480 (SA111_00684) | - | 628382..628717 (-) | 336 | WP_000360288.1 | hypothetical protein | - |
| BJR96_RS03485 (SA111_00685) | - | 628863..629048 (+) | 186 | WP_000263692.1 | helix-turn-helix domain-containing protein | - |
| BJR96_RS03490 (SA111_00686) | - | 629127..629438 (+) | 312 | WP_001123481.1 | hypothetical protein | - |
| BJR96_RS12110 (SA111_00687) | - | 629443..629592 (+) | 150 | WP_000732607.1 | hypothetical protein | - |
| BJR96_RS03495 (SA111_00689) | - | 629668..629868 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| BJR96_RS03500 (SA111_00690) | - | 629865..630155 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| BJR96_RS03505 (SA111_00691) | - | 630142..630825 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| BJR96_RS03510 (SA111_00692) | - | 630831..632264 (+) | 1434 | Protein_613 | DEAD/DEAH box helicase | - |
| BJR96_RS03515 (SA111_00693) | - | 632269..632751 (+) | 483 | WP_000896928.1 | DUF669 domain-containing protein | - |
| BJR96_RS03520 (SA111_00694) | - | 632769..634322 (+) | 1554 | WP_070001311.1 | phage resistance protein | - |
| BJR96_RS03525 (SA111_00695) | - | 634588..635460 (+) | 873 | WP_070001310.1 | bifunctional DNA primase/polymerase | - |
| BJR96_RS03530 (SA111_00696) | - | 635480..635761 (+) | 282 | WP_032469116.1 | VRR-NUC domain-containing protein | - |
| BJR96_RS03535 (SA111_00697) | - | 635840..636136 (+) | 297 | WP_070001309.1 | nucleotide modification associated domain-containing protein | - |
| BJR96_RS12115 (SA111_00698) | - | 636120..636278 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| BJR96_RS03540 (SA111_00699) | - | 636275..636640 (+) | 366 | WP_069986686.1 | YopX family protein | - |
| BJR96_RS03545 (SA111_00700) | - | 636914..637348 (+) | 435 | WP_070001308.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BJR96_RS03555 | - | 637979..638355 (+) | 377 | Protein_622 | HNH endonuclease | - |
| BJR96_RS03560 | - | 638506..638862 (+) | 357 | Protein_623 | hypothetical protein | - |
| BJR96_RS03565 (SA111_00703) | - | 638859..640126 (+) | 1268 | Protein_624 | hypothetical protein | - |
| BJR96_RS03570 (SA111_00704) | - | 640119..641339 (+) | 1221 | WP_000227335.1 | polymorphic toxin type 50 domain-containing protein | - |
| BJR96_RS03575 (SA111_00705) | - | 641339..641527 (+) | 189 | WP_000421991.1 | hypothetical protein | - |
| BJR96_RS03580 (SA111_00706) | - | 641635..643050 (+) | 1416 | WP_000256854.1 | terminase large subunit | - |
| BJR96_RS03585 (SA111_00707) | - | 643131..643595 (+) | 465 | WP_001288696.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| BJR96_RS03590 (SA111_00708) | - | 643598..644500 (+) | 903 | WP_000841024.1 | phage major capsid protein | - |
| BJR96_RS03595 (SA111_00709) | - | 644497..644712 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| BJR96_RS03600 (SA111_00710) | - | 644726..645157 (+) | 432 | WP_000180799.1 | phage Gp19/Gp15/Gp42 family protein | - |
| BJR96_RS03605 (SA111_00711) | - | 645108..645446 (+) | 339 | WP_001096306.1 | hypothetical protein | - |
| BJR96_RS03610 (SA111_00712) | - | 645439..645675 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| BJR96_RS03615 | - | 645676..646010 (+) | 335 | Protein_634 | hypothetical protein | - |
| BJR96_RS03620 (SA111_00714) | - | 646020..646577 (+) | 558 | WP_000226353.1 | tail protein | - |
| BJR96_RS03625 (SA111_00715) | - | 646577..646822 (+) | 246 | WP_069986694.1 | hypothetical protein | - |
| BJR96_RS03630 (SA111_00716) | - | 646837..647187 (+) | 351 | WP_070005689.1 | DUF5361 domain-containing protein | - |
| BJR96_RS03635 (SA111_00717) | - | 647210..649222 (+) | 2013 | WP_069986695.1 | PblA | - |
| BJR96_RS03640 (SA111_00718) | - | 649216..650748 (+) | 1533 | WP_069986152.1 | distal tail protein Dit | - |
| BJR96_RS03645 (SA111_00719) | - | 650749..654561 (+) | 3813 | WP_070005687.1 | glucosaminidase domain-containing protein | - |
| BJR96_RS03650 (SA111_00720) | - | 654562..656553 (+) | 1992 | WP_070001270.1 | DUF859 family phage minor structural protein | - |
| BJR96_RS03655 (SA111_00721) | - | 656568..656957 (+) | 390 | WP_070002982.1 | DUF1366 domain-containing protein | - |
| BJR96_RS12420 | - | 656980..657108 (+) | 129 | WP_000973385.1 | hypothetical protein | - |
| BJR96_RS03660 (SA111_00723) | - | 657117..657419 (+) | 303 | WP_001018078.1 | hypothetical protein | - |
| BJR96_RS03665 (SA111_00724) | - | 657412..657639 (+) | 228 | WP_000609114.1 | phage holin | - |
| BJR96_RS03670 (SA111_00726) | - | 657767..659110 (+) | 1344 | WP_069987850.1 | GH25 family lysozyme | - |
| BJR96_RS03675 (SA111_00727) | - | 659476..659988 (+) | 513 | WP_000634506.1 | PBECR4 domain-containing protein | - |
| BJR96_RS11855 (SA111_00728) | - | 660148..660347 (+) | 200 | Protein_648 | CsbD family protein | - |
| BJR96_RS03685 (SA111_00729) | - | 660428..660679 (-) | 252 | WP_000455663.1 | hypothetical protein | - |
| BJR96_RS12120 (SA111_00730) | - | 660820..660966 (-) | 147 | WP_171898157.1 | hypothetical protein | - |
| BJR96_RS03690 (SA111_00731) | - | 661116..661325 (+) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| BJR96_RS03695 (SA111_00732) | prx | 661448..661627 (+) | 180 | WP_000965647.1 | hypothetical protein | Regulator |
| BJR96_RS12430 | - | 661984..662307 (-) | 324 | WP_233263921.1 | tyrosine-type recombinase/integrase | - |
| BJR96_RS03700 (SA111_00733) | - | 662343..662609 (-) | 267 | WP_001872365.1 | hypothetical protein | - |
| BJR96_RS12245 | - | 662615..663992 (+) | 1378 | Protein_655 | IS3 family transposase | - |
| BJR96_RS11465 | - | 664165..664326 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| BJR96_RS03720 (SA111_00737) | - | 664534..665478 (+) | 945 | WP_000222594.1 | IS30 family transposase | - |
| BJR96_RS03725 (SA111_00738) | - | 666119..667395 (+) | 1277 | Protein_658 | ABC transporter permease | - |
| BJR96_RS03730 (SA111_00739) | - | 667405..668061 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| BJR96_RS03735 (SA111_00740) | - | 668061..669437 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| BJR96_RS03740 (SA111_00741) | - | 669534..670187 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| BJR96_RS03745 (SA111_00742) | - | 670184..671485 (+) | 1302 | WP_000734168.1 | sensor histidine kinase | - |
| BJR96_RS03750 (SA111_00743) | - | 671537..672184 (-) | 648 | Protein_663 | IS3 family transposase | - |
| BJR96_RS03755 (SA111_00744) | - | 672362..672541 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| BJR96_RS11470 | prx | 672583..672771 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| BJR96_RS03760 (SA111_00745) | - | 673196..674401 (+) | 1206 | WP_000078931.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| BJR96_RS03765 (SA111_00746) | - | 674520..675080 (+) | 561 | WP_001106189.1 | HAD-IA family hydrolase | - |
| BJR96_RS03770 (SA111_00747) | gyrB | 675081..677033 (+) | 1953 | WP_000134199.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| BJR96_RS03775 (SA111_00748) | ezrA | 677127..678851 (+) | 1725 | WP_000094341.1 | septation ring formation regulator EzrA | - |
| BJR96_RS03780 (SA111_00749) | serB | 678945..679586 (+) | 642 | WP_000589685.1 | phosphoserine phosphatase SerB | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7017.06 Da Isoelectric Point: 4.4621
>NTDB_id=1143691 BJR96_RS03695 WP_000965647.1 661448..661627(+) (prx) [Streptococcus agalactiae isolate SA111]
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVEDVMRELR
MLYIDEFKEAIDRGYIMGSTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVEDVMRELR
Nucleotide
Download Length: 180 bp
>NTDB_id=1143691 BJR96_RS03695 WP_000965647.1 661448..661627(+) (prx) [Streptococcus agalactiae isolate SA111]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGACG
TTATGAGAGAATTGAGGTGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAGAGGATATATTATGGGAAGCACAGTTGCGATCGTACGAAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGACG
TTATGAGAGAATTGAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
72.881 |
0.542 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |