Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | BJR96_RS03225 | Genome accession | NZ_LT545678 |
| Coordinates | 579497..579676 (+) | Length | 59 a.a. |
| NCBI ID | WP_069986155.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae isolate SA111 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 542157..582690 | 579497..579676 | within | 0 |
| IScluster/Tn | 580360..581705 | 579497..579676 | flank | 684 |
Gene organization within MGE regions
Location: 542157..582690
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BJR96_RS02985 (SA111_00573) | - | 542175..543014 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| BJR96_RS02990 (SA111_00574) | - | 542989..543591 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| BJR96_RS02995 (SA111_00575) | - | 543694..543969 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| BJR96_RS03000 (SA111_00576) | - | 544057..545199 (-) | 1143 | WP_017646861.1 | tyrosine-type recombinase/integrase | - |
| BJR96_RS03005 (SA111_00577) | - | 545327..545536 (-) | 210 | WP_000442169.1 | TM2 domain-containing protein | - |
| BJR96_RS03010 (SA111_00578) | - | 545761..546492 (-) | 732 | WP_070005686.1 | S24 family peptidase | - |
| BJR96_RS03015 (SA111_00579) | - | 546669..546872 (+) | 204 | WP_000658998.1 | hypothetical protein | - |
| BJR96_RS03020 (SA111_00580) | - | 546856..547215 (-) | 360 | WP_000359716.1 | hypothetical protein | - |
| BJR96_RS03025 (SA111_00581) | - | 547288..547506 (+) | 219 | WP_001198775.1 | helix-turn-helix transcriptional regulator | - |
| BJR96_RS03030 (SA111_00582) | - | 547518..547850 (+) | 333 | WP_000158652.1 | hypothetical protein | - |
| BJR96_RS03035 (SA111_00584) | - | 547955..548290 (-) | 336 | WP_000360288.1 | hypothetical protein | - |
| BJR96_RS03040 (SA111_00585) | - | 548436..548621 (+) | 186 | WP_000263692.1 | helix-turn-helix domain-containing protein | - |
| BJR96_RS03045 (SA111_00586) | - | 548700..549011 (+) | 312 | WP_001123481.1 | hypothetical protein | - |
| BJR96_RS12080 (SA111_00587) | - | 549016..549165 (+) | 150 | WP_000732607.1 | hypothetical protein | - |
| BJR96_RS03050 (SA111_00589) | - | 549241..549441 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| BJR96_RS03055 (SA111_00590) | - | 549438..549728 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| BJR96_RS03060 (SA111_00591) | - | 549715..550398 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| BJR96_RS03065 (SA111_00592) | - | 550404..551837 (+) | 1434 | Protein_522 | DEAD/DEAH box helicase | - |
| BJR96_RS03070 (SA111_00593) | - | 551842..552324 (+) | 483 | WP_000896928.1 | DUF669 domain-containing protein | - |
| BJR96_RS03075 (SA111_00594) | - | 552342..553895 (+) | 1554 | WP_070001311.1 | phage resistance protein | - |
| BJR96_RS03080 (SA111_00595) | - | 554161..555033 (+) | 873 | WP_070001310.1 | bifunctional DNA primase/polymerase | - |
| BJR96_RS03085 (SA111_00596) | - | 555053..555334 (+) | 282 | WP_032469116.1 | VRR-NUC domain-containing protein | - |
| BJR96_RS03090 (SA111_00597) | - | 555413..555709 (+) | 297 | WP_070001309.1 | nucleotide modification associated domain-containing protein | - |
| BJR96_RS12085 (SA111_00598) | - | 555693..555851 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| BJR96_RS03095 (SA111_00599) | - | 555848..556213 (+) | 366 | WP_069986686.1 | YopX family protein | - |
| BJR96_RS03100 (SA111_00600) | - | 556487..556921 (+) | 435 | WP_070001308.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BJR96_RS03110 | - | 557551..557928 (+) | 378 | WP_069986158.1 | HNH endonuclease | - |
| BJR96_RS03115 (SA111_00602) | - | 558079..558434 (+) | 356 | Protein_532 | hypothetical protein | - |
| BJR96_RS12180 | - | 558431..559688 (+) | 1258 | Protein_533 | hypothetical protein | - |
| BJR96_RS12105 | - | 559674..560898 (+) | 1225 | Protein_534 | polymorphic toxin type 50 domain-containing protein | - |
| BJR96_RS03130 (SA111_00607) | - | 560898..561086 (+) | 189 | WP_000421991.1 | hypothetical protein | - |
| BJR96_RS03135 (SA111_00608) | - | 561194..562609 (+) | 1416 | WP_000256854.1 | terminase large subunit | - |
| BJR96_RS03140 (SA111_00609) | - | 562690..563154 (+) | 465 | WP_001288696.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| BJR96_RS03145 (SA111_00610) | - | 563157..564059 (+) | 903 | WP_000841024.1 | phage major capsid protein | - |
| BJR96_RS03150 (SA111_00611) | - | 564056..564271 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| BJR96_RS03155 (SA111_00612) | - | 564285..564716 (+) | 432 | WP_000180799.1 | phage Gp19/Gp15/Gp42 family protein | - |
| BJR96_RS03160 (SA111_00613) | - | 564667..565005 (+) | 339 | WP_001096306.1 | hypothetical protein | - |
| BJR96_RS03165 (SA111_00614) | - | 564998..565234 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| BJR96_RS03170 (SA111_00615) | - | 565235..565570 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| BJR96_RS12565 | - | 565580..566123 (+) | 544 | Protein_544 | phage tail protein | - |
| BJR96_RS03180 | - | 566388..566761 (+) | 374 | Protein_545 | DUF5361 domain-containing protein | - |
| BJR96_RS12505 | - | 566761..568765 (+) | 2005 | Protein_546 | phage tail protein | - |
| BJR96_RS03190 (SA111_00622) | - | 568759..570290 (+) | 1532 | Protein_547 | distal tail protein Dit | - |
| BJR96_RS03195 (SA111_00623) | - | 570291..574103 (+) | 3813 | WP_070005687.1 | glucosaminidase domain-containing protein | - |
| BJR96_RS03200 (SA111_00624) | - | 574104..576095 (+) | 1992 | WP_070001270.1 | DUF859 family phage minor structural protein | - |
| BJR96_RS03205 (SA111_00625) | - | 576110..576499 (+) | 390 | WP_070002982.1 | DUF1366 domain-containing protein | - |
| BJR96_RS12405 | - | 576522..576650 (+) | 129 | WP_000973385.1 | hypothetical protein | - |
| BJR96_RS03210 (SA111_00627) | - | 576659..576961 (+) | 303 | WP_001018078.1 | hypothetical protein | - |
| BJR96_RS03215 (SA111_00628) | - | 576954..577181 (+) | 228 | WP_000609114.1 | phage holin | - |
| BJR96_RS03220 (SA111_00630) | - | 577309..578652 (+) | 1344 | WP_069987850.1 | GH25 family lysozyme | - |
| BJR96_RS11435 (SA111_00631) | - | 578909..579079 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| BJR96_RS12410 | - | 579215..579340 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| BJR96_RS03225 (SA111_00632) | prx | 579497..579676 (+) | 180 | WP_069986155.1 | Paratox | Regulator |
| BJR96_RS03230 (SA111_00633) | - | 580082..580279 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| BJR96_RS03240 (SA111_00635) | - | 580360..581705 (+) | 1346 | WP_371316017.1 | IS3-like element IS861 family transposase | - |
| BJR96_RS03245 (SA111_00636) | - | 581758..582690 (-) | 933 | WP_000254068.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6910.83 Da Isoelectric Point: 4.1317
>NTDB_id=1143689 BJR96_RS03225 WP_069986155.1 579497..579676(+) (prx) [Streptococcus agalactiae isolate SA111]
MLYIDELQEAIDKGYISGNTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVEDVMRELE
MLYIDELQEAIDKGYISGNTVAIVRKNGKIFDYVLPHEEVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1143689 BJR96_RS03225 WP_069986155.1 579497..579676(+) (prx) [Streptococcus agalactiae isolate SA111]
ATGTTATATATAGATGAGCTACAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGACG
TTATGAGAGAATTGGAGTAA
ATGTTATATATAGATGAGCTACAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAGAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGACG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
100 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
98.305 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |