Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN68_RS03705 | Genome accession | NZ_LS483522 |
| Coordinates | 681487..681669 (+) | Length | 60 a.a. |
| NCBI ID | WP_021733609.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8224 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 642104..681669 | 681487..681669 | within | 0 |
Gene organization within MGE regions
Location: 642104..681669
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN68_RS03425 (NCTC8224_00674) | recN | 642104..643765 (+) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
| DQN68_RS03430 (NCTC8224_00675) | - | 643930..644877 (+) | 948 | WP_021734034.1 | LPXTG cell wall anchor domain-containing protein | - |
| DQN68_RS03435 (NCTC8224_00676) | - | 645105..645944 (+) | 840 | WP_002989125.1 | DegV family protein | - |
| DQN68_RS03440 (NCTC8224_00677) | - | 645937..646779 (+) | 843 | WP_172453874.1 | SGNH/GDSL hydrolase family protein | - |
| DQN68_RS03445 (NCTC8224_00678) | - | 646757..647344 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQN68_RS03450 (NCTC8224_00679) | - | 647443..647718 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQN68_RS03455 (NCTC8224_00680) | - | 647807..648949 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQN68_RS03460 (NCTC8224_00681) | - | 649073..649591 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQN68_RS03465 (NCTC8224_00682) | - | 649603..650358 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQN68_RS03470 (NCTC8224_00683) | - | 650560..650772 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQN68_RS03475 (NCTC8224_00685) | - | 651042..651353 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQN68_RS03480 (NCTC8224_00686) | - | 651355..651540 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQN68_RS09470 | - | 651634..651903 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQN68_RS03490 (NCTC8224_00687) | - | 652044..652430 (+) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| DQN68_RS03495 (NCTC8224_00688) | - | 652411..652644 (+) | 234 | WP_111712461.1 | hypothetical protein | - |
| DQN68_RS03500 (NCTC8224_00689) | - | 652641..652781 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| DQN68_RS03505 (NCTC8224_00690) | - | 652790..652996 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| DQN68_RS03510 (NCTC8224_00691) | - | 653052..653381 (+) | 330 | WP_011888754.1 | hypothetical protein | - |
| DQN68_RS03515 (NCTC8224_00692) | bet | 653384..654160 (+) | 777 | WP_011888755.1 | phage recombination protein Bet | - |
| DQN68_RS03520 (NCTC8224_00693) | - | 654170..655198 (+) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| DQN68_RS03525 (NCTC8224_00694) | - | 655394..655735 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| DQN68_RS03530 (NCTC8224_00695) | - | 655732..656244 (+) | 513 | WP_011888758.1 | hypothetical protein | - |
| DQN68_RS09475 (NCTC8224_00696) | - | 656231..656416 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| DQN68_RS09350 | - | 656421..656591 (+) | 171 | WP_168389619.1 | hypothetical protein | - |
| DQN68_RS03540 (NCTC8224_00697) | - | 656858..657277 (+) | 420 | WP_021733384.1 | DUF1492 domain-containing protein | - |
| DQN68_RS03545 | - | 657387..657731 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| DQN68_RS03550 (NCTC8224_00698) | - | 657880..658236 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQN68_RS03555 (NCTC8224_00699) | - | 658233..659501 (+) | 1269 | WP_093974638.1 | phage portal protein | - |
| DQN68_RS03560 (NCTC8224_00700) | - | 659494..660987 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQN68_RS03565 (NCTC8224_00701) | - | 660993..661217 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQN68_RS03570 (NCTC8224_00702) | - | 661267..661446 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| DQN68_RS03575 (NCTC8224_00703) | - | 661439..661705 (+) | 267 | WP_093974640.1 | hypothetical protein | - |
| DQN68_RS03580 (NCTC8224_00704) | - | 661815..663230 (+) | 1416 | WP_111712462.1 | terminase | - |
| DQN68_RS03585 (NCTC8224_00705) | - | 663312..663773 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQN68_RS03590 (NCTC8224_00706) | - | 663798..664709 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| DQN68_RS03595 (NCTC8224_00707) | - | 664709..664909 (+) | 201 | WP_021733480.1 | HeH/LEM domain protein | - |
| DQN68_RS03600 (NCTC8224_00708) | - | 664919..665341 (+) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQN68_RS03605 (NCTC8224_00709) | - | 665301..665639 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQN68_RS03610 (NCTC8224_00710) | - | 665632..665868 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQN68_RS03615 (NCTC8224_00711) | - | 665869..666204 (+) | 336 | WP_021733481.1 | hypothetical protein | - |
| DQN68_RS03620 (NCTC8224_00712) | - | 666220..666810 (+) | 591 | WP_021733477.1 | hypothetical protein | - |
| DQN68_RS03625 (NCTC8224_00713) | - | 666821..667084 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQN68_RS03630 (NCTC8224_00714) | - | 667099..667470 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| DQN68_RS03635 (NCTC8224_00715) | - | 667470..667997 (+) | 528 | Protein_641 | hypothetical protein | - |
| DQN68_RS03640 (NCTC8224_00716) | - | 668170..668730 (+) | 561 | WP_011017973.1 | HNH endonuclease | - |
| DQN68_RS03645 (NCTC8224_00717) | - | 668938..670746 (+) | 1809 | WP_002992580.1 | hypothetical protein | - |
| DQN68_RS03650 (NCTC8224_00718) | - | 670743..671438 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQN68_RS03655 (NCTC8224_00719) | - | 671420..673393 (+) | 1974 | WP_168642169.1 | phage tail spike protein | - |
| DQN68_RS03660 (NCTC8224_00721) | - | 673393..674393 (+) | 1001 | Protein_646 | hyaluronoglucosaminidase | - |
| DQN68_RS03665 (NCTC8224_00722) | - | 674408..676192 (+) | 1785 | WP_111712465.1 | gp58-like family protein | - |
| DQN68_RS03670 (NCTC8224_00723) | - | 676204..676635 (+) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| DQN68_RS03675 (NCTC8224_00724) | - | 676638..677255 (+) | 618 | WP_011017592.1 | DUF1366 domain-containing protein | - |
| DQN68_RS03680 (NCTC8224_00725) | - | 677265..677540 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQN68_RS03685 (NCTC8224_00726) | - | 677537..677764 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQN68_RS03690 (NCTC8224_00727) | - | 677880..679085 (+) | 1206 | WP_109820921.1 | glucosaminidase domain-containing protein | - |
| DQN68_RS03695 (NCTC8224_00728) | - | 679220..680344 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| DQN68_RS03700 (NCTC8224_00729) | entC3 | 680592..681374 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| DQN68_RS03705 (NCTC8224_00730) | prx | 681487..681669 (+) | 183 | WP_021733609.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6959.86 Da Isoelectric Point: 4.2103
>NTDB_id=1142889 DQN68_RS03705 WP_021733609.1 681487..681669(+) (prx) [Streptococcus pyogenes strain NCTC8224]
MLTYNEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEVRNGEVVTDEKVEEVLVELSR
MLTYNEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEVRNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1142889 DQN68_RS03705 WP_021733609.1 681487..681669(+) (prx) [Streptococcus pyogenes strain NCTC8224]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
88.333 |
100 |
0.883 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |