Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN68_RS02990 | Genome accession | NZ_LS483522 |
| Coordinates | 548218..548400 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8224 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 508920..548400 | 548218..548400 | within | 0 |
Gene organization within MGE regions
Location: 508920..548400
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN68_RS02710 (NCTC8224_00530) | - | 508920..510086 (-) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
| DQN68_RS02715 (NCTC8224_00531) | - | 510268..511689 (-) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| DQN68_RS02720 (NCTC8224_00532) | - | 511704..512090 (-) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN68_RS02725 (NCTC8224_00533) | - | 512074..512415 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| DQN68_RS02730 (NCTC8224_00534) | - | 512613..512825 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| DQN68_RS02735 (NCTC8224_00535) | - | 512853..513572 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| DQN68_RS02740 (NCTC8224_00536) | - | 513670..513909 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQN68_RS02745 (NCTC8224_00537) | - | 514076..514261 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQN68_RS02750 (NCTC8224_00538) | - | 514332..514583 (+) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| DQN68_RS02755 (NCTC8224_00539) | - | 514614..514751 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DQN68_RS02760 (NCTC8224_00541) | - | 514845..515606 (+) | 762 | WP_014635613.1 | DnaD domain protein | - |
| DQN68_RS02765 (NCTC8224_00542) | - | 515593..516375 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| DQN68_RS02770 (NCTC8224_00544) | - | 516516..516869 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DQN68_RS02775 (NCTC8224_00545) | - | 516850..517104 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| DQN68_RS02780 (NCTC8224_00546) | - | 517126..517608 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQN68_RS02785 (NCTC8224_00547) | - | 517609..518283 (+) | 675 | WP_014635611.1 | ERF family protein | - |
| DQN68_RS02790 (NCTC8224_00548) | ssb | 518276..518701 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| DQN68_RS02795 | - | 518707..518910 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQN68_RS02800 (NCTC8224_00549) | - | 518910..519350 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQN68_RS02805 (NCTC8224_00550) | - | 519347..519703 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DQN68_RS09645 (NCTC8224_00551) | - | 519700..519945 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| DQN68_RS02815 (NCTC8224_00552) | - | 519945..520181 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DQN68_RS09340 (NCTC8224_00553) | - | 520178..520348 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DQN68_RS02820 (NCTC8224_00554) | - | 520345..520629 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DQN68_RS02825 (NCTC8224_00555) | - | 520631..521263 (+) | 633 | WP_011017868.1 | N-6 DNA methylase | - |
| DQN68_RS02830 (NCTC8224_00556) | - | 521266..521625 (+) | 360 | Protein_481 | DUF1642 domain-containing protein | - |
| DQN68_RS02835 (NCTC8224_00557) | - | 521719..522153 (+) | 435 | WP_063632930.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN68_RS02840 (NCTC8224_00558) | - | 522383..522565 (+) | 183 | Protein_483 | DNA methyltransferase | - |
| DQN68_RS02845 (NCTC8224_00559) | - | 522909..523385 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| DQN68_RS02850 (NCTC8224_00560) | - | 523468..524679 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DQN68_RS02855 (NCTC8224_00561) | - | 524693..526195 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| DQN68_RS02860 (NCTC8224_00562) | - | 526200..527693 (+) | 1494 | WP_014635607.1 | phage minor capsid protein | - |
| DQN68_RS02865 (NCTC8224_00563) | - | 527693..527920 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| DQN68_RS02870 (NCTC8224_00564) | - | 528007..528273 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| DQN68_RS02875 (NCTC8224_00565) | - | 528399..529013 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| DQN68_RS02880 (NCTC8224_00566) | - | 529017..529835 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQN68_RS02885 (NCTC8224_00567) | - | 529889..530305 (+) | 417 | WP_010922081.1 | hypothetical protein | - |
| DQN68_RS02890 (NCTC8224_00568) | - | 530295..530627 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| DQN68_RS02895 (NCTC8224_00569) | - | 530627..530983 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQN68_RS02900 (NCTC8224_00570) | - | 530980..531378 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| DQN68_RS02905 (NCTC8224_00571) | - | 531378..531839 (+) | 462 | WP_011018120.1 | phage tail tube protein | - |
| DQN68_RS02910 (NCTC8224_00572) | - | 531883..532317 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| DQN68_RS02915 (NCTC8224_00573) | - | 532321..532902 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| DQN68_RS02920 (NCTC8224_00574) | - | 532892..536152 (+) | 3261 | WP_023605204.1 | tape measure protein | - |
| DQN68_RS02925 (NCTC8224_00575) | - | 536149..536865 (+) | 717 | WP_023605203.1 | distal tail protein Dit | - |
| DQN68_RS02930 (NCTC8224_00576) | - | 536862..539009 (+) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| DQN68_RS02935 (NCTC8224_00577) | - | 539009..540118 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| DQN68_RS02940 (NCTC8224_00578) | - | 540128..542011 (+) | 1884 | WP_109828896.1 | gp58-like family protein | - |
| DQN68_RS02945 (NCTC8224_00579) | - | 542023..542454 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQN68_RS02950 (NCTC8224_00580) | - | 542457..543074 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| DQN68_RS02955 (NCTC8224_00581) | - | 543084..543359 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQN68_RS02960 (NCTC8224_00582) | - | 543356..543583 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQN68_RS02965 (NCTC8224_00583) | - | 543699..544907 (+) | 1209 | WP_023609806.1 | glucosaminidase domain-containing protein | - |
| DQN68_RS02970 (NCTC8224_00584) | - | 545046..545570 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQN68_RS02975 (NCTC8224_00585) | - | 545558..546424 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| DQN68_RS02980 (NCTC8224_00586) | - | 546474..546908 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQN68_RS02985 (NCTC8224_00587) | sda3 | 547180..547980 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQN68_RS02990 (NCTC8224_00588) | prx | 548218..548400 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=1142886 DQN68_RS02990 WP_011184907.1 548218..548400(+) (prx) [Streptococcus pyogenes strain NCTC8224]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1142886 DQN68_RS02990 WP_011184907.1 548218..548400(+) (prx) [Streptococcus pyogenes strain NCTC8224]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |