Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN35_RS03540 | Genome accession | NZ_LS483442 |
| Coordinates | 659618..659800 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8370 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 624988..659800 | 659618..659800 | within | 0 |
Gene organization within MGE regions
Location: 624988..659800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN35_RS03255 (NCTC8370_00640) | - | 624988..625263 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQN35_RS03260 (NCTC8370_00641) | - | 625353..626495 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQN35_RS03265 (NCTC8370_00642) | - | 626619..626885 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| DQN35_RS03270 (NCTC8370_00643) | - | 626897..627277 (-) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN35_RS03275 (NCTC8370_00644) | - | 627281..627628 (-) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| DQN35_RS03280 | - | 628051..628146 (-) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQN35_RS03290 (NCTC8370_00646) | - | 628799..629932 (-) | 1134 | WP_011285737.1 | ISAs1-like element IS1548 family transposase | - |
| DQN35_RS03295 (NCTC8370_00647) | - | 630107..630298 (+) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQN35_RS03300 (NCTC8370_00648) | - | 630310..631026 (+) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| DQN35_RS03305 (NCTC8370_00649) | - | 631058..631324 (+) | 267 | WP_010922204.1 | hypothetical protein | - |
| DQN35_RS03310 (NCTC8370_00650) | - | 631259..632065 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQN35_RS03315 (NCTC8370_00651) | - | 632207..632446 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQN35_RS03320 (NCTC8370_00652) | - | 632613..632798 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQN35_RS03325 (NCTC8370_00653) | - | 632876..633187 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| DQN35_RS03330 (NCTC8370_00654) | - | 633189..633374 (+) | 186 | WP_011285628.1 | hypothetical protein | - |
| DQN35_RS09370 | - | 633474..633713 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| DQN35_RS03340 (NCTC8370_00655) | - | 633858..634247 (+) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| DQN35_RS03345 (NCTC8370_00656) | - | 634228..634461 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| DQN35_RS03350 (NCTC8370_00657) | - | 634458..634598 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| DQN35_RS03355 (NCTC8370_00658) | - | 634607..634813 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| DQN35_RS03360 (NCTC8370_00659) | - | 634869..635198 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| DQN35_RS03365 (NCTC8370_00660) | - | 635201..636130 (+) | 930 | WP_011285626.1 | recombinase RecT | - |
| DQN35_RS03370 (NCTC8370_00661) | - | 636127..636924 (+) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQN35_RS09255 (NCTC8370_00662) | - | 636934..637101 (+) | 168 | WP_011285624.1 | hypothetical protein | - |
| DQN35_RS03375 (NCTC8370_00663) | - | 637279..637620 (+) | 342 | WP_020837403.1 | hypothetical protein | - |
| DQN35_RS03380 (NCTC8370_00664) | - | 637617..638129 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| DQN35_RS03385 (NCTC8370_00665) | - | 638213..638482 (+) | 270 | WP_002988369.1 | hypothetical protein | - |
| DQN35_RS03390 (NCTC8370_00666) | - | 638484..639119 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| DQN35_RS03395 (NCTC8370_00667) | - | 639387..639806 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| DQN35_RS03400 | - | 639915..640259 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| DQN35_RS03405 (NCTC8370_00668) | - | 640408..640764 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQN35_RS03410 (NCTC8370_00669) | - | 640761..642029 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQN35_RS03415 (NCTC8370_00670) | - | 642022..643515 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQN35_RS03420 (NCTC8370_00671) | - | 643521..643745 (+) | 225 | WP_010922466.1 | hypothetical protein | - |
| DQN35_RS03425 (NCTC8370_00672) | - | 643795..643974 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| DQN35_RS03430 (NCTC8370_00673) | - | 643967..644233 (+) | 267 | WP_010922464.1 | hypothetical protein | - |
| DQN35_RS03435 (NCTC8370_00674) | - | 644343..645758 (+) | 1416 | WP_011285619.1 | terminase | - |
| DQN35_RS03440 (NCTC8370_00675) | - | 645839..646300 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQN35_RS03445 (NCTC8370_00676) | - | 646325..647236 (+) | 912 | WP_010922461.1 | phage major capsid protein | - |
| DQN35_RS03450 (NCTC8370_00677) | - | 647236..647436 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQN35_RS03455 (NCTC8370_00678) | - | 647446..647868 (+) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQN35_RS03460 (NCTC8370_00679) | - | 647828..648166 (+) | 339 | WP_011285617.1 | hypothetical protein | - |
| DQN35_RS03465 (NCTC8370_00680) | - | 648159..648395 (+) | 237 | WP_010922457.1 | hypothetical protein | - |
| DQN35_RS03470 (NCTC8370_00681) | - | 648396..648731 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQN35_RS03475 (NCTC8370_00682) | - | 648743..649336 (+) | 594 | WP_010922456.1 | tail protein | - |
| DQN35_RS03480 (NCTC8370_00683) | - | 649347..649610 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQN35_RS03485 (NCTC8370_00684) | - | 649625..649996 (+) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| DQN35_RS03490 (NCTC8370_00685) | - | 649996..652353 (+) | 2358 | WP_010922453.1 | hypothetical protein | - |
| DQN35_RS03495 (NCTC8370_00686) | - | 652350..653045 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| DQN35_RS03500 (NCTC8370_00687) | - | 653042..654910 (+) | 1869 | WP_111713457.1 | gp58-like family protein | - |
| DQN35_RS03505 (NCTC8370_00688) | - | 654922..655359 (+) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| DQN35_RS03510 (NCTC8370_00689) | - | 655356..655973 (+) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| DQN35_RS03515 (NCTC8370_00690) | - | 655983..656258 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQN35_RS03520 (NCTC8370_00691) | - | 656255..656482 (+) | 228 | WP_111713458.1 | phage holin | - |
| DQN35_RS03525 (NCTC8370_00692) | - | 656598..657803 (+) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| DQN35_RS03530 (NCTC8370_00693) | - | 657873..658307 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQN35_RS03535 (NCTC8370_00694) | sda3 | 658579..659379 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQN35_RS03540 (NCTC8370_00695) | prx | 659618..659800 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1141652 DQN35_RS03540 WP_011017964.1 659618..659800(+) (prx) [Streptococcus pyogenes strain NCTC8370]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1141652 DQN35_RS03540 WP_011017964.1 659618..659800(+) (prx) [Streptococcus pyogenes strain NCTC8370]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |