Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN29_RS06735 | Genome accession | NZ_LS483437 |
| Coordinates | 1283933..1284115 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain NCTC13751 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1283933..1325369 | 1283933..1284115 | within | 0 |
Gene organization within MGE regions
Location: 1283933..1325369
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN29_RS06735 (NCTC13751_01363) | prx | 1283933..1284115 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| DQN29_RS06745 (NCTC13751_01365) | - | 1284461..1285036 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQN29_RS06750 (NCTC13751_01366) | spek | 1285512..1286291 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DQN29_RS06755 (NCTC13751_01367) | - | 1286595..1287461 (-) | 867 | WP_076639317.1 | DUF334 domain-containing protein | - |
| DQN29_RS06760 (NCTC13751_01368) | - | 1287449..1287973 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQN29_RS06765 (NCTC13751_01369) | - | 1288113..1289315 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| DQN29_RS06770 (NCTC13751_01371) | - | 1289431..1289658 (-) | 228 | WP_011054444.1 | phage holin | - |
| DQN29_RS06775 (NCTC13751_01372) | - | 1289655..1289927 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQN29_RS06780 (NCTC13751_01373) | - | 1289939..1290571 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| DQN29_RS06785 (NCTC13751_01374) | - | 1290574..1291002 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQN29_RS06790 (NCTC13751_01375) | - | 1291014..1292903 (-) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| DQN29_RS06795 (NCTC13751_01376) | - | 1292914..1293228 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| DQN29_RS06800 (NCTC13751_01377) | - | 1293230..1294444 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DQN29_RS06805 (NCTC13751_01378) | - | 1294441..1296588 (-) | 2148 | WP_076639318.1 | phage tail spike protein | - |
| DQN29_RS06810 (NCTC13751_01379) | - | 1296585..1297301 (-) | 717 | WP_076639319.1 | distal tail protein Dit | - |
| DQN29_RS06815 (NCTC13751_01380) | - | 1297298..1300558 (-) | 3261 | WP_076639320.1 | tape measure protein | - |
| DQN29_RS06820 (NCTC13751_01381) | - | 1300548..1301129 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| DQN29_RS06825 (NCTC13751_01382) | - | 1301133..1301567 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| DQN29_RS06830 (NCTC13751_01383) | - | 1301606..1302091 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQN29_RS06835 (NCTC13751_01384) | - | 1302091..1302489 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQN29_RS06840 (NCTC13751_01385) | - | 1302486..1302842 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQN29_RS06845 (NCTC13751_01386) | - | 1302842..1303174 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQN29_RS06850 (NCTC13751_01387) | - | 1303164..1303580 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| DQN29_RS06855 (NCTC13751_01388) | - | 1303634..1304452 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQN29_RS06860 (NCTC13751_01389) | - | 1304456..1305070 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| DQN29_RS06865 (NCTC13751_01390) | - | 1305196..1305462 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQN29_RS06870 (NCTC13751_01391) | - | 1305524..1305763 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQN29_RS06875 (NCTC13751_01392) | - | 1305735..1307213 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DQN29_RS06880 (NCTC13751_01393) | - | 1307218..1308720 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| DQN29_RS06885 (NCTC13751_01394) | - | 1308734..1310025 (-) | 1292 | Protein_1300 | PBSX family phage terminase large subunit | - |
| DQN29_RS06890 (NCTC13751_01395) | - | 1310028..1310501 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| DQN29_RS06895 (NCTC13751_01396) | - | 1310552..1310929 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DQN29_RS06900 | - | 1310990..1311421 (-) | 432 | WP_074375320.1 | GNAT family N-acetyltransferase | - |
| DQN29_RS06905 (NCTC13751_01397) | - | 1311399..1311917 (-) | 519 | WP_076639322.1 | ParB N-terminal domain-containing protein | - |
| DQN29_RS06910 | - | 1311998..1312255 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| DQN29_RS06930 (NCTC13751_01398) | - | 1312894..1313334 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN29_RS09935 (NCTC13751_01399) | - | 1313608..1313778 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| DQN29_RS06935 (NCTC13751_01400) | - | 1313775..1314281 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DQN29_RS09940 (NCTC13751_01401) | - | 1314278..1314448 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| DQN29_RS06940 (NCTC13751_01402) | - | 1314445..1314849 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| DQN29_RS06945 (NCTC13751_01403) | - | 1314859..1315128 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| DQN29_RS06950 (NCTC13751_01404) | - | 1315125..1315409 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DQN29_RS06955 (NCTC13751_01405) | - | 1315403..1315654 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| DQN29_RS06960 (NCTC13751_01406) | - | 1315651..1316007 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| DQN29_RS06965 (NCTC13751_01407) | - | 1316004..1316444 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQN29_RS06970 | - | 1316444..1316647 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQN29_RS06975 (NCTC13751_01408) | ssbA | 1316653..1317072 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| DQN29_RS06980 (NCTC13751_01409) | - | 1317065..1317739 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| DQN29_RS06985 (NCTC13751_01410) | - | 1317740..1318222 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQN29_RS06990 (NCTC13751_01411) | - | 1318244..1318498 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| DQN29_RS06995 (NCTC13751_01412) | - | 1318509..1318649 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| DQN29_RS07000 (NCTC13751_01413) | - | 1318646..1318879 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| DQN29_RS07005 (NCTC13751_01414) | - | 1318860..1319273 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| DQN29_RS07010 (NCTC13751_01415) | - | 1319395..1319652 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| DQN29_RS07015 (NCTC13751_01416) | - | 1319746..1319931 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| DQN29_RS07020 (NCTC13751_01417) | - | 1319960..1320217 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| DQN29_RS07030 (NCTC13751_01419) | - | 1320463..1320630 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| DQN29_RS07035 (NCTC13751_01420) | - | 1320706..1320906 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DQN29_RS09945 (NCTC13751_01421) | - | 1320903..1321052 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| DQN29_RS07040 (NCTC13751_01422) | - | 1321085..1321813 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| DQN29_RS07045 (NCTC13751_01423) | - | 1321824..1322015 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| DQN29_RS07050 (NCTC13751_01424) | - | 1322817..1323170 (+) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| DQN29_RS07055 (NCTC13751_01425) | - | 1323184..1323564 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN29_RS07060 (NCTC13751_01426) | - | 1323575..1324096 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| DQN29_RS07065 (NCTC13751_01427) | - | 1324272..1325369 (+) | 1098 | WP_015967409.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=1141519 DQN29_RS06735 WP_011054726.1 1283933..1284115(-) (prx) [Streptococcus pyogenes strain NCTC13751]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1141519 DQN29_RS06735 WP_011054726.1 1283933..1284115(-) (prx) [Streptococcus pyogenes strain NCTC13751]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |