Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN29_RS06160 | Genome accession | NZ_LS483437 |
| Coordinates | 1183126..1183308 (-) | Length | 60 a.a. |
| NCBI ID | WP_032463717.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC13751 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1183126..1225893 | 1183126..1183308 | within | 0 |
Gene organization within MGE regions
Location: 1183126..1225893
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN29_RS06160 (NCTC13751_01241) | prx | 1183126..1183308 (-) | 183 | WP_032463717.1 | hypothetical protein | Regulator |
| DQN29_RS06165 (NCTC13751_01242) | spel | 1183423..1184211 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| DQN29_RS06170 (NCTC13751_01243) | spem | 1184493..1185206 (-) | 714 | WP_032463716.1 | streptococcal pyrogenic exotoxin SpeM | - |
| DQN29_RS06175 (NCTC13751_01244) | - | 1185590..1186150 (-) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| DQN29_RS06180 (NCTC13751_01245) | - | 1186183..1186347 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| DQN29_RS06185 (NCTC13751_01246) | - | 1186496..1187137 (-) | 642 | Protein_1158 | CHAP domain-containing protein | - |
| DQN29_RS06190 (NCTC13751_01247) | - | 1187250..1187942 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| DQN29_RS06195 (NCTC13751_01248) | - | 1188178..1188732 (-) | 555 | Protein_1160 | glycoside hydrolase family 73 protein | - |
| DQN29_RS06200 (NCTC13751_01250) | - | 1188843..1189028 (-) | 186 | WP_011054731.1 | holin | - |
| DQN29_RS06205 (NCTC13751_01251) | - | 1189025..1189321 (-) | 297 | WP_023078532.1 | hypothetical protein | - |
| DQN29_RS06210 (NCTC13751_01252) | - | 1189332..1189964 (-) | 633 | WP_023611372.1 | hypothetical protein | - |
| DQN29_RS06215 (NCTC13751_01253) | - | 1189967..1190395 (-) | 429 | WP_032463718.1 | DUF1617 family protein | - |
| DQN29_RS06220 (NCTC13751_01254) | - | 1190407..1192293 (-) | 1887 | WP_076639305.1 | gp58-like family protein | - |
| DQN29_RS06225 (NCTC13751_01255) | hylP | 1192308..1193321 (-) | 1014 | WP_032463712.1 | hyaluronidase HylP | - |
| DQN29_RS10215 (NCTC13751_01256) | - | 1193321..1195426 (-) | 2106 | WP_050436577.1 | phage tail spike protein | - |
| DQN29_RS06235 (NCTC13751_01257) | - | 1195423..1196193 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| DQN29_RS06240 (NCTC13751_01258) | - | 1196193..1198940 (-) | 2748 | WP_050436576.1 | phage tail tape measure protein | - |
| DQN29_RS06245 (NCTC13751_01259) | - | 1198940..1199257 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| DQN29_RS06250 (NCTC13751_01260) | - | 1199278..1199646 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| DQN29_RS06255 (NCTC13751_01261) | - | 1199700..1200218 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| DQN29_RS06260 (NCTC13751_01262) | - | 1200206..1200604 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| DQN29_RS06265 (NCTC13751_01263) | - | 1200601..1200957 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQN29_RS06270 (NCTC13751_01264) | - | 1200957..1201253 (-) | 297 | WP_032463711.1 | hypothetical protein | - |
| DQN29_RS06275 (NCTC13751_01265) | - | 1201250..1201603 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| DQN29_RS06280 (NCTC13751_01266) | - | 1201615..1201881 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| DQN29_RS06285 (NCTC13751_01267) | - | 1201893..1202942 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| DQN29_RS06290 (NCTC13751_01268) | - | 1202945..1203325 (-) | 381 | WP_002990036.1 | structural protein | - |
| DQN29_RS06295 (NCTC13751_01269) | - | 1203335..1203868 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| DQN29_RS06300 (NCTC13751_01270) | - | 1204012..1204278 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| DQN29_RS06305 (NCTC13751_01271) | - | 1204294..1205208 (-) | 915 | WP_032463710.1 | minor capsid protein | - |
| DQN29_RS06310 (NCTC13751_01272) | - | 1205189..1206679 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| DQN29_RS06315 (NCTC13751_01273) | - | 1206691..1207998 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| DQN29_RS06320 (NCTC13751_01274) | - | 1207976..1208428 (-) | 453 | WP_030127432.1 | terminase small subunit | - |
| DQN29_RS06325 (NCTC13751_01275) | - | 1208518..1208934 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQN29_RS09915 (NCTC13751_01276) | - | 1208918..1209064 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| DQN29_RS06330 (NCTC13751_01277) | - | 1209067..1209339 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQN29_RS09920 (NCTC13751_01278) | - | 1209332..1209502 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| DQN29_RS06335 (NCTC13751_01279) | - | 1209503..1210825 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| DQN29_RS06340 (NCTC13751_01280) | - | 1210822..1211097 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQN29_RS06345 (NCTC13751_01281) | - | 1211483..1213867 (-) | 2385 | WP_032463709.1 | phage/plasmid primase, P4 family | - |
| DQN29_RS06350 (NCTC13751_01282) | - | 1213872..1215794 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| DQN29_RS06355 (NCTC13751_01283) | - | 1215837..1216400 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQN29_RS06360 (NCTC13751_01284) | - | 1216409..1217566 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQN29_RS06365 (NCTC13751_01285) | - | 1217566..1217865 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQN29_RS06370 (NCTC13751_01286) | - | 1217953..1218156 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| DQN29_RS09925 (NCTC13751_01287) | - | 1218153..1218305 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| DQN29_RS06375 (NCTC13751_01288) | - | 1218302..1218688 (-) | 387 | WP_030127425.1 | hypothetical protein | - |
| DQN29_RS06380 (NCTC13751_01289) | - | 1218685..1218888 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| DQN29_RS06385 (NCTC13751_01290) | - | 1218881..1219051 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQN29_RS06390 (NCTC13751_01291) | - | 1219053..1219364 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQN29_RS06395 (NCTC13751_01292) | - | 1219442..1219627 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQN29_RS06400 (NCTC13751_01293) | - | 1219794..1220033 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQN29_RS06405 (NCTC13751_01294) | - | 1220183..1220392 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQN29_RS06415 (NCTC13751_01296) | - | 1220638..1220844 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| DQN29_RS06420 (NCTC13751_01297) | - | 1220918..1221400 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| DQN29_RS09930 (NCTC13751_01298) | - | 1221397..1221543 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| DQN29_RS06425 (NCTC13751_01299) | - | 1221598..1222197 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| DQN29_RS06430 (NCTC13751_01300) | - | 1222228..1222386 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| DQN29_RS06435 (NCTC13751_01302) | - | 1222776..1223534 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| DQN29_RS06440 (NCTC13751_01303) | - | 1223569..1224249 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| DQN29_RS06445 (NCTC13751_01304) | - | 1224386..1225528 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQN29_RS06450 (NCTC13751_01305) | - | 1225618..1225893 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6949.84 Da Isoelectric Point: 4.0606
>NTDB_id=1141516 DQN29_RS06160 WP_032463717.1 1183126..1183308(-) (prx) [Streptococcus pyogenes strain NCTC13751]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1141516 DQN29_RS06160 WP_032463717.1 1183126..1183308(-) (prx) [Streptococcus pyogenes strain NCTC13751]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
96.667 |
0.967 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |