Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN29_RS04355 | Genome accession | NZ_LS483437 |
| Coordinates | 805259..805447 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain NCTC13751 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 766402..812039 | 805259..805447 | within | 0 |
Gene organization within MGE regions
Location: 766402..812039
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN29_RS04095 (NCTC13751_00815) | - | 766402..766995 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| DQN29_RS04100 (NCTC13751_00816) | rfbB | 767239..768279 (+) | 1041 | WP_076639686.1 | dTDP-glucose 4,6-dehydratase | - |
| DQN29_RS04105 (NCTC13751_00817) | - | 768362..769501 (-) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| DQN29_RS04110 (NCTC13751_00818) | - | 769623..770309 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| DQN29_RS09855 (NCTC13751_00819) | - | 770480..770632 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| DQN29_RS04115 (NCTC13751_00820) | - | 770643..771020 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN29_RS04120 (NCTC13751_00821) | - | 771004..771363 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQN29_RS04125 (NCTC13751_00822) | - | 771552..771770 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQN29_RS04130 (NCTC13751_00823) | - | 771865..772116 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| DQN29_RS10160 (NCTC13751_00824) | - | 772147..772281 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| DQN29_RS04135 (NCTC13751_00825) | - | 772297..772611 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| DQN29_RS04140 (NCTC13751_00826) | - | 772838..773320 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| DQN29_RS04145 (NCTC13751_00827) | - | 773321..774001 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQN29_RS04150 (NCTC13751_00828) | - | 774103..775332 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DQN29_RS04155 (NCTC13751_00829) | - | 775348..775806 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| DQN29_RS04160 (NCTC13751_00830) | - | 775809..776621 (+) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| DQN29_RS04165 (NCTC13751_00831) | - | 776611..778092 (+) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| DQN29_RS04170 (NCTC13751_00832) | - | 778337..778657 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| DQN29_RS04175 (NCTC13751_00833) | - | 778641..778997 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQN29_RS10200 (NCTC13751_00834) | - | 778994..779245 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| DQN29_RS04185 (NCTC13751_00835) | - | 779239..779523 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| DQN29_RS04190 (NCTC13751_00836) | - | 779520..779789 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQN29_RS04195 (NCTC13751_00837) | - | 779799..780203 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| DQN29_RS09860 (NCTC13751_00838) | - | 780200..780370 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| DQN29_RS04200 (NCTC13751_00839) | - | 780367..780873 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DQN29_RS09865 (NCTC13751_00840) | - | 780870..781040 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| DQN29_RS04205 (NCTC13751_00841) | - | 781314..781754 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN29_RS04210 (NCTC13751_00842) | - | 781902..782282 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQN29_RS04215 (NCTC13751_00843) | - | 782272..783546 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| DQN29_RS04220 (NCTC13751_00844) | - | 783546..784871 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| DQN29_RS04225 (NCTC13751_00845) | - | 784840..785748 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| DQN29_RS04230 (NCTC13751_00846) | - | 785755..785985 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| DQN29_RS04235 (NCTC13751_00847) | - | 786097..786666 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| DQN29_RS04240 (NCTC13751_00848) | - | 786685..787575 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQN29_RS04245 (NCTC13751_00849) | - | 787587..787880 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| DQN29_RS04250 (NCTC13751_00850) | - | 787894..788238 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| DQN29_RS04255 (NCTC13751_00851) | - | 788235..788546 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| DQN29_RS04260 (NCTC13751_00852) | - | 788543..788938 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| DQN29_RS04265 (NCTC13751_00853) | - | 788940..789350 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| DQN29_RS04270 (NCTC13751_00854) | - | 789362..789868 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| DQN29_RS04275 (NCTC13751_00855) | - | 789881..790198 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| DQN29_RS04280 (NCTC13751_00856) | - | 790171..790629 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| DQN29_RS04285 (NCTC13751_00857) | - | 790622..792427 (+) | 1806 | WP_011528565.1 | tail protein | - |
| DQN29_RS04290 (NCTC13751_00858) | - | 792428..793912 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| DQN29_RS04295 (NCTC13751_00859) | - | 793913..797362 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| DQN29_RS04300 (NCTC13751_00860) | - | 797367..799229 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| DQN29_RS04305 (NCTC13751_00861) | - | 799240..799587 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQN29_RS10165 (NCTC13751_00862) | - | 799601..799723 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQN29_RS04310 (NCTC13751_00863) | - | 799737..800060 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQN29_RS04315 (NCTC13751_00864) | - | 800060..800392 (+) | 333 | WP_011054798.1 | phage holin | - |
| DQN29_RS04320 (NCTC13751_00865) | - | 800394..801158 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQN29_RS04325 (NCTC13751_00866) | - | 801170..801772 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQN29_RS04330 (NCTC13751_00867) | - | 801783..802556 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| DQN29_RS04335 (NCTC13751_00868) | - | 802566..802787 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQN29_RS04340 (NCTC13751_00869) | - | 802787..803446 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| DQN29_RS04345 (NCTC13751_00870) | - | 803515..803949 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQN29_RS04350 (NCTC13751_00871) | sda3 | 804221..805021 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQN29_RS04355 (NCTC13751_00872) | prx | 805259..805447 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| DQN29_RS04360 (NCTC13751_00873) | - | 805855..806331 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| DQN29_RS04365 (NCTC13751_00874) | - | 806389..807570 (+) | 1182 | WP_038432925.1 | AI-2E family transporter | - |
| DQN29_RS04370 (NCTC13751_00875) | - | 807560..808807 (+) | 1248 | WP_032460151.1 | tetratricopeptide repeat protein | - |
| DQN29_RS04375 (NCTC13751_00876) | fbp54 | 808866..810518 (-) | 1653 | WP_076639624.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| DQN29_RS04380 (NCTC13751_00877) | trpX | 810872..811870 (+) | 999 | WP_076639625.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1141510 DQN29_RS04355 WP_011528571.1 805259..805447(+) (prx) [Streptococcus pyogenes strain NCTC13751]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1141510 DQN29_RS04355 WP_011528571.1 805259..805447(+) (prx) [Streptococcus pyogenes strain NCTC13751]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |