Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | T303_RS11065 | Genome accession | NZ_CP006819 |
| Coordinates | 926638..926799 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus ASCC 1275 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 905871..934495 | 926638..926799 | within | 0 |
Gene organization within MGE regions
Location: 905871..934495
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| T303_RS04900 (T303_04955) | - | 905871..906467 (+) | 597 | WP_011225787.1 | thymidine kinase | - |
| T303_RS04905 (T303_04960) | prfA | 906504..907583 (+) | 1080 | WP_002948472.1 | peptide chain release factor 1 | - |
| T303_RS04910 (T303_04965) | prmC | 907580..908413 (+) | 834 | WP_011681016.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| T303_RS04915 (T303_04970) | - | 908400..909005 (+) | 606 | WP_002948474.1 | L-threonylcarbamoyladenylate synthase | - |
| T303_RS04920 (T303_04975) | glyA | 909100..910350 (+) | 1251 | WP_011227085.1 | serine hydroxymethyltransferase | - |
| T303_RS04925 (T303_04980) | - | 910357..911334 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| T303_RS04930 (T303_04985) | - | 911336..911947 (+) | 612 | WP_014621429.1 | lysozyme family protein | - |
| T303_RS04935 (T303_04990) | - | 911980..913719 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| T303_RS04940 (T303_04995) | - | 913709..915457 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| T303_RS04945 | - | 915634..915765 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| T303_RS04950 (T303_05005) | dltA | 915774..917324 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| T303_RS04955 (T303_05010) | dltB | 917321..918568 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| T303_RS04960 (T303_05015) | dltC | 918586..918825 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| T303_RS04965 (T303_05020) | dltD | 918818..920086 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| T303_RS10760 | - | 920139..921488 (-) | 1350 | Protein_926 | IS3 family transposase | - |
| T303_RS04995 (T303_05040) | - | 921687..924323 (-) | 2637 | WP_014621434.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| T303_RS05000 (T303_05045) | pabB | 924500..926218 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| T303_RS11065 (T303_05050) | prx | 926638..926799 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| T303_RS05010 (T303_05060) | - | 927283..927558 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| T303_RS05015 (T303_05065) | - | 927575..927760 (-) | 186 | WP_024704073.1 | hypothetical protein | - |
| T303_RS05020 (T303_05075) | - | 928058..929563 (-) | 1506 | WP_024704074.1 | DNA primase family protein | - |
| T303_RS05025 (T303_05080) | - | 929553..930413 (-) | 861 | WP_024704075.1 | primase alpha helix C-terminal domain-containing protein | - |
| T303_RS05030 (T303_05085) | - | 930428..930700 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| T303_RS05040 (T303_05095) | - | 930943..931179 (-) | 237 | WP_024704076.1 | hypothetical protein | - |
| T303_RS05045 (T303_05100) | - | 931193..931387 (-) | 195 | WP_024704077.1 | hypothetical protein | - |
| T303_RS05050 (T303_05105) | - | 931391..931684 (-) | 294 | WP_024704078.1 | hypothetical protein | - |
| T303_RS05055 (T303_05110) | - | 931923..932120 (-) | 198 | WP_014608200.1 | helix-turn-helix transcriptional regulator | - |
| T303_RS10205 (T303_05115) | - | 932283..932795 (+) | 513 | WP_014608201.1 | helix-turn-helix transcriptional regulator | - |
| T303_RS05065 (T303_05120) | - | 932878..934044 (+) | 1167 | WP_011227104.1 | site-specific integrase | - |
| T303_RS05070 (T303_05125) | - | 934160..934495 (+) | 336 | WP_002948199.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=114115 T303_RS11065 WP_014727422.1 926638..926799(-) (prx) [Streptococcus thermophilus ASCC 1275]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=114115 T303_RS11065 WP_014727422.1 926638..926799(-) (prx) [Streptococcus thermophilus ASCC 1275]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |