Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN31_RS03585 | Genome accession | NZ_LS483421 |
| Coordinates | 675210..675392 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC10877 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 631089..675392 | 675210..675392 | within | 0 |
Gene organization within MGE regions
Location: 631089..675392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN31_RS03275 (NCTC10877_00639) | - | 631089..631364 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQN31_RS03280 (NCTC10877_00640) | - | 631454..632596 (-) | 1143 | WP_111697155.1 | tyrosine-type recombinase/integrase | - |
| DQN31_RS03285 (NCTC10877_00641) | - | 632719..633024 (-) | 306 | WP_011106738.1 | membrane protein | - |
| DQN31_RS03290 (NCTC10877_00642) | - | 633034..633822 (-) | 789 | WP_014411883.1 | S24 family peptidase | - |
| DQN31_RS03295 (NCTC10877_00644) | - | 634195..634353 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQN31_RS03300 (NCTC10877_00645) | - | 634383..634982 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQN31_RS03305 (NCTC10877_00646) | - | 635076..635315 (+) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| DQN31_RS03315 (NCTC10877_00648) | - | 635527..636333 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQN31_RS03325 (NCTC10877_00650) | - | 636586..636795 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQN31_RS03330 (NCTC10877_00651) | - | 636946..637185 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQN31_RS03335 (NCTC10877_00652) | - | 637352..637537 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQN31_RS03340 (NCTC10877_00653) | - | 637615..637926 (+) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQN31_RS09220 (NCTC10877_00654) | - | 637928..638062 (+) | 135 | WP_012560975.1 | hypothetical protein | - |
| DQN31_RS03345 (NCTC10877_00655) | - | 638078..638392 (+) | 315 | WP_014411879.1 | helix-turn-helix domain-containing protein | - |
| DQN31_RS03350 (NCTC10877_00656) | - | 638540..639022 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQN31_RS03355 (NCTC10877_00657) | - | 639023..639703 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQN31_RS03360 (NCTC10877_00658) | - | 639805..641034 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DQN31_RS03365 (NCTC10877_00659) | - | 641050..641508 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQN31_RS03370 (NCTC10877_00660) | - | 641511..642323 (+) | 813 | WP_014411877.1 | bifunctional DNA primase/polymerase | - |
| DQN31_RS03375 (NCTC10877_00661) | - | 642313..643788 (+) | 1476 | WP_014411876.1 | DNA primase family protein | - |
| DQN31_RS03380 (NCTC10877_00662) | - | 644050..644463 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQN31_RS03385 (NCTC10877_00663) | - | 644460..644780 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DQN31_RS03390 | - | 644764..645121 (+) | 358 | Protein_587 | hypothetical protein | - |
| DQN31_RS09260 (NCTC10877_00665) | - | 645118..645358 (+) | 241 | Protein_588 | hypothetical protein | - |
| DQN31_RS03400 (NCTC10877_00666) | - | 645352..645636 (+) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| DQN31_RS03405 (NCTC10877_00667) | - | 645633..645902 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQN31_RS03410 (NCTC10877_00668) | - | 645912..646265 (+) | 354 | WP_111697156.1 | YopX family protein | - |
| DQN31_RS03415 (NCTC10877_00669) | - | 646262..646546 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQN31_RS03420 (NCTC10877_00670) | - | 646548..647180 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQN31_RS03425 (NCTC10877_00671) | - | 647183..647893 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQN31_RS03430 (NCTC10877_00672) | - | 647890..648261 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQN31_RS03435 (NCTC10877_00673) | - | 648537..648977 (+) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN31_RS03445 (NCTC10877_00674) | - | 649562..649900 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQN31_RS03450 (NCTC10877_00675) | - | 650071..650538 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQN31_RS03455 (NCTC10877_00676) | - | 650553..652307 (+) | 1755 | WP_014411864.1 | terminase large subunit | - |
| DQN31_RS09050 (NCTC10877_00677) | - | 652304..652474 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQN31_RS03460 (NCTC10877_00678) | - | 652467..652691 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQN31_RS03465 (NCTC10877_00679) | - | 652725..653945 (+) | 1221 | WP_014411863.1 | phage portal protein | - |
| DQN31_RS03470 (NCTC10877_00680) | - | 653923..654588 (+) | 666 | WP_023610933.1 | head maturation protease, ClpP-related | - |
| DQN31_RS03475 (NCTC10877_00681) | - | 654614..655816 (+) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| DQN31_RS09055 | - | 655803..655949 (+) | 147 | WP_023610896.1 | hypothetical protein | - |
| DQN31_RS03480 (NCTC10877_00682) | - | 655952..656254 (+) | 303 | WP_014411860.1 | head-tail connector protein | - |
| DQN31_RS03485 (NCTC10877_00683) | - | 656251..656598 (+) | 348 | WP_002985351.1 | phage head closure protein | - |
| DQN31_RS03490 (NCTC10877_00684) | - | 656595..656972 (+) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQN31_RS03495 (NCTC10877_00685) | - | 656969..657394 (+) | 426 | WP_002985347.1 | hypothetical protein | - |
| DQN31_RS03500 (NCTC10877_00686) | - | 657411..658019 (+) | 609 | WP_014411858.1 | major tail protein | - |
| DQN31_RS03505 (NCTC10877_00687) | gpG | 658072..658398 (+) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DQN31_RS09060 (NCTC10877_00688) | - | 658428..658595 (+) | 168 | WP_014411856.1 | hypothetical protein | - |
| DQN31_RS03510 (NCTC10877_00689) | - | 658608..662531 (+) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| DQN31_RS03515 (NCTC10877_00690) | - | 662531..663238 (+) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DQN31_RS03520 (NCTC10877_00692) | - | 663235..665379 (+) | 2145 | Protein_615 | phage tail spike protein | - |
| DQN31_RS03525 (NCTC10877_00693) | hylP | 665376..666398 (+) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| DQN31_RS03530 (NCTC10877_00694) | - | 666411..668297 (+) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| DQN31_RS03535 (NCTC10877_00695) | - | 668309..668737 (+) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| DQN31_RS03540 (NCTC10877_00696) | - | 668740..669378 (+) | 639 | WP_023610893.1 | hypothetical protein | - |
| DQN31_RS03545 (NCTC10877_00697) | - | 669388..669663 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQN31_RS03550 (NCTC10877_00698) | - | 669660..669887 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQN31_RS03555 (NCTC10877_00700) | - | 670003..671211 (+) | 1209 | WP_014411848.1 | glucosaminidase domain-containing protein | - |
| DQN31_RS03560 (NCTC10877_00701) | - | 671351..671875 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQN31_RS03565 (NCTC10877_00702) | - | 671863..672729 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| DQN31_RS03570 (NCTC10877_00703) | spek | 673034..673813 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DQN31_RS03575 (NCTC10877_00704) | - | 674289..674864 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQN31_RS03585 (NCTC10877_00706) | prx | 675210..675392 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1141055 DQN31_RS03585 WP_011017964.1 675210..675392(+) (prx) [Streptococcus pyogenes strain NCTC10877]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1141055 DQN31_RS03585 WP_011017964.1 675210..675392(+) (prx) [Streptococcus pyogenes strain NCTC10877]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |