Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN75_RS03505 | Genome accession | NZ_LS483420 |
| Coordinates | 658475..658657 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain NCTC13739 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 624367..658657 | 658475..658657 | within | 0 |
Gene organization within MGE regions
Location: 624367..658657
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN75_RS03245 (NCTC13739_00638) | - | 624367..624642 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQN75_RS03250 (NCTC13739_00639) | - | 624731..625873 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQN75_RS03255 (NCTC13739_00640) | - | 625997..626515 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQN75_RS03260 (NCTC13739_00641) | - | 626527..627282 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQN75_RS03265 (NCTC13739_00642) | - | 627485..627697 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQN75_RS03270 (NCTC13739_00644) | - | 627967..628278 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQN75_RS03275 (NCTC13739_00645) | - | 628280..628465 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQN75_RS09100 | - | 628559..628828 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQN75_RS03285 (NCTC13739_00646) | - | 628969..629355 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQN75_RS03290 (NCTC13739_00647) | - | 629336..629569 (+) | 234 | WP_002988350.1 | hypothetical protein | - |
| DQN75_RS03295 (NCTC13739_00648) | - | 629566..629706 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| DQN75_RS03300 (NCTC13739_00649) | - | 629715..629921 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| DQN75_RS03305 (NCTC13739_00650) | - | 629977..630306 (+) | 330 | WP_063629030.1 | hypothetical protein | - |
| DQN75_RS03310 (NCTC13739_00651) | bet | 630309..631100 (+) | 792 | WP_002990071.1 | phage recombination protein Bet | - |
| DQN75_RS03315 (NCTC13739_00652) | - | 631110..632138 (+) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| DQN75_RS03320 (NCTC13739_00653) | - | 632335..632676 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| DQN75_RS03325 (NCTC13739_00654) | - | 632673..633185 (+) | 513 | WP_111684749.1 | hypothetical protein | - |
| DQN75_RS09105 (NCTC13739_00655) | - | 633172..633357 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| DQN75_RS03335 (NCTC13739_00656) | - | 633362..633631 (+) | 270 | WP_111684751.1 | hypothetical protein | - |
| DQN75_RS03340 (NCTC13739_00657) | - | 633634..634383 (+) | 750 | WP_080465051.1 | DNA-methyltransferase | - |
| DQN75_RS03345 (NCTC13739_00659) | - | 634892..635311 (+) | 420 | WP_111684753.1 | DUF1492 domain-containing protein | - |
| DQN75_RS03350 | - | 635418..635762 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| DQN75_RS03355 (NCTC13739_00660) | - | 635911..636267 (+) | 357 | WP_032461152.1 | hypothetical protein | - |
| DQN75_RS03360 (NCTC13739_00661) | - | 636264..637532 (+) | 1269 | WP_032461151.1 | phage portal protein | - |
| DQN75_RS03365 (NCTC13739_00662) | - | 637525..639018 (+) | 1494 | WP_111684755.1 | hypothetical protein | - |
| DQN75_RS03370 (NCTC13739_00663) | - | 639024..639248 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQN75_RS03375 (NCTC13739_00664) | - | 639298..639477 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| DQN75_RS03380 (NCTC13739_00665) | - | 639470..639736 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQN75_RS03385 (NCTC13739_00666) | - | 639738..639974 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| DQN75_RS03390 (NCTC13739_00667) | - | 640056..641471 (+) | 1416 | WP_063631462.1 | hypothetical protein | - |
| DQN75_RS03395 (NCTC13739_00668) | - | 641542..642003 (+) | 462 | WP_032461147.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQN75_RS03400 (NCTC13739_00669) | - | 642028..642939 (+) | 912 | WP_063631463.1 | phage major capsid protein | - |
| DQN75_RS03405 (NCTC13739_00670) | - | 642939..643139 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQN75_RS03410 (NCTC13739_00671) | - | 643149..643571 (+) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQN75_RS03415 (NCTC13739_00672) | - | 643531..643869 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQN75_RS03420 (NCTC13739_00673) | - | 643862..644098 (+) | 237 | WP_111676592.1 | hypothetical protein | - |
| DQN75_RS03425 (NCTC13739_00674) | - | 644099..644434 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQN75_RS03430 (NCTC13739_00675) | - | 644446..645030 (+) | 585 | WP_111684757.1 | phage tail protein | - |
| DQN75_RS03435 (NCTC13739_00676) | - | 645040..645303 (+) | 264 | WP_032461128.1 | hypothetical protein | - |
| DQN75_RS03440 (NCTC13739_00677) | - | 645318..645689 (+) | 372 | WP_032461127.1 | DUF5361 domain-containing protein | - |
| DQN75_RS03445 (NCTC13739_00678) | - | 645689..648052 (+) | 2364 | WP_111676586.1 | hypothetical protein | - |
| DQN75_RS03450 (NCTC13739_00679) | - | 648049..648744 (+) | 696 | WP_111676584.1 | hypothetical protein | - |
| DQN75_RS03455 (NCTC13739_00680) | - | 648726..650696 (+) | 1971 | WP_172454111.1 | phage tail spike protein | - |
| DQN75_RS03460 (NCTC13739_00681) | hylP | 650693..651718 (+) | 1026 | WP_111684761.1 | hyaluronidase HylP | - |
| DQN75_RS03465 (NCTC13739_00682) | - | 651731..653671 (+) | 1941 | WP_063631467.1 | gp58-like family protein | - |
| DQN75_RS03470 (NCTC13739_00683) | - | 653683..654111 (+) | 429 | WP_111684763.1 | DUF1617 family protein | - |
| DQN75_RS03475 (NCTC13739_00684) | - | 654114..654746 (+) | 633 | WP_011017396.1 | hypothetical protein | - |
| DQN75_RS03480 (NCTC13739_00685) | - | 654758..655030 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQN75_RS03485 (NCTC13739_00686) | - | 655027..655254 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQN75_RS03490 (NCTC13739_00688) | - | 655373..656590 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| DQN75_RS03495 (NCTC13739_00689) | speC | 656659..657366 (-) | 708 | WP_111684765.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQN75_RS03500 (NCTC13739_00690) | mf2 | 657477..658235 (-) | 759 | WP_111684767.1 | DNase Mf2 | - |
| DQN75_RS03505 (NCTC13739_00691) | prx | 658475..658657 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=1141003 DQN75_RS03505 WP_014635572.1 658475..658657(+) (prx) [Streptococcus pyogenes strain NCTC13739]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1141003 DQN75_RS03505 WP_014635572.1 658475..658657(+) (prx) [Streptococcus pyogenes strain NCTC13739]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |