Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM79_RS06810 | Genome accession | NZ_LS483401 |
| Coordinates | 1337424..1337603 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain NCTC10085 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1337424..1378041 | 1337424..1337603 | within | 0 |
Gene organization within MGE regions
Location: 1337424..1378041
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM79_RS06810 (NCTC10085_01343) | prx | 1337424..1337603 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| DQM79_RS06815 (NCTC10085_01344) | sda1 | 1337842..1339014 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| DQM79_RS06820 (NCTC10085_01345) | - | 1339130..1340326 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| DQM79_RS06825 (NCTC10085_01347) | - | 1340437..1340622 (-) | 186 | WP_002988802.1 | holin | - |
| DQM79_RS06830 (NCTC10085_01348) | - | 1340619..1340918 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| DQM79_RS06835 (NCTC10085_01349) | - | 1340929..1341549 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| DQM79_RS06840 (NCTC10085_01350) | - | 1341552..1341713 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| DQM79_RS06845 (NCTC10085_01351) | - | 1341722..1343629 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| DQM79_RS06850 (NCTC10085_01352) | - | 1343640..1344275 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| DQM79_RS06855 (NCTC10085_01353) | - | 1344275..1345330 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| DQM79_RS06860 (NCTC10085_01354) | - | 1345327..1347309 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| DQM79_RS06865 (NCTC10085_01355) | - | 1347319..1348161 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| DQM79_RS06870 (NCTC10085_01356) | - | 1348173..1352555 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| DQM79_RS06875 (NCTC10085_01357) | - | 1352570..1352803 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| DQM79_RS06880 (NCTC10085_01358) | - | 1352878..1353333 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DQM79_RS06885 (NCTC10085_01359) | - | 1353387..1353986 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| DQM79_RS06890 (NCTC10085_01360) | - | 1353998..1354357 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| DQM79_RS06895 (NCTC10085_01361) | - | 1354361..1354705 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM79_RS06900 (NCTC10085_01362) | - | 1354702..1354980 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| DQM79_RS06905 (NCTC10085_01363) | - | 1354991..1355347 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| DQM79_RS06910 (NCTC10085_01364) | - | 1355359..1356246 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| DQM79_RS06915 (NCTC10085_01365) | - | 1356259..1356828 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| DQM79_RS06920 (NCTC10085_01366) | - | 1356984..1357250 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| DQM79_RS06925 | - | 1357253..1357441 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| DQM79_RS06930 (NCTC10085_01368) | - | 1357472..1358917 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| DQM79_RS06935 (NCTC10085_01369) | - | 1358877..1360409 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| DQM79_RS06940 (NCTC10085_01370) | - | 1360425..1361702 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| DQM79_RS06945 (NCTC10085_01371) | - | 1361692..1362144 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| DQM79_RS06950 (NCTC10085_01372) | - | 1362234..1362650 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DQM79_RS06955 (NCTC10085_01373) | - | 1362647..1362838 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| DQM79_RS06960 (NCTC10085_01374) | - | 1362828..1363679 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| DQM79_RS06965 (NCTC10085_01375) | - | 1363688..1363954 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| DQM79_RS09175 (NCTC10085_01376) | - | 1363951..1364118 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| DQM79_RS06970 (NCTC10085_01377) | - | 1364119..1365441 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| DQM79_RS06975 (NCTC10085_01378) | - | 1365438..1365713 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| DQM79_RS06980 (NCTC10085_01379) | - | 1366100..1368484 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| DQM79_RS06985 (NCTC10085_01380) | - | 1368489..1370411 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| DQM79_RS06990 (NCTC10085_01381) | - | 1370454..1371011 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| DQM79_RS06995 (NCTC10085_01382) | - | 1371022..1371420 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| DQM79_RS07000 (NCTC10085_01383) | - | 1371424..1372578 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| DQM79_RS07005 (NCTC10085_01384) | - | 1372578..1372877 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| DQM79_RS07010 (NCTC10085_01385) | - | 1372965..1373168 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| DQM79_RS07015 (NCTC10085_01387) | - | 1373315..1373701 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| DQM79_RS07020 (NCTC10085_01388) | - | 1373698..1373901 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| DQM79_RS07025 (NCTC10085_01389) | - | 1373894..1374064 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| DQM79_RS07030 (NCTC10085_01390) | - | 1374061..1374336 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| DQM79_RS07035 (NCTC10085_01391) | - | 1374398..1374613 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| DQM79_RS07040 (NCTC10085_01392) | - | 1374661..1375074 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| DQM79_RS09180 (NCTC10085_01393) | - | 1375055..1375210 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| DQM79_RS07045 (NCTC10085_01394) | - | 1375536..1375886 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| DQM79_RS07050 (NCTC10085_01395) | - | 1375900..1376283 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM79_RS07055 (NCTC10085_01396) | - | 1376294..1376845 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| DQM79_RS07060 (NCTC10085_01397) | - | 1376962..1378041 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1140302 DQM79_RS06810 WP_002988813.1 1337424..1337603(-) (prx) [Streptococcus pyogenes strain NCTC10085]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1140302 DQM79_RS06810 WP_002988813.1 1337424..1337603(-) (prx) [Streptococcus pyogenes strain NCTC10085]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |