Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   DQM80_RS06385 Genome accession   NZ_LS483399
Coordinates   1245747..1245929 (-) Length   60 a.a.
NCBI ID   WP_011184907.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain NCTC8227     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1245747..1289668 1245747..1245929 within 0


Gene organization within MGE regions


Location: 1245747..1289668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQM80_RS06385 (NCTC8227_01281) prx 1245747..1245929 (-) 183 WP_011184907.1 hypothetical protein Regulator
  DQM80_RS06390 (NCTC8227_01282) sda3 1246167..1246967 (+) 801 WP_011285611.1 streptodornase Sda3 -
  DQM80_RS06395 (NCTC8227_01283) - 1247239..1247673 (+) 435 WP_011017966.1 hypothetical protein -
  DQM80_RS06400 (NCTC8227_01284) - 1247723..1248589 (-) 867 WP_011888701.1 DUF334 domain-containing protein -
  DQM80_RS06405 (NCTC8227_01285) - 1248577..1249101 (-) 525 WP_011017840.1 Panacea domain-containing protein -
  DQM80_RS06410 (NCTC8227_01286) - 1249241..1250443 (-) 1203 WP_111702223.1 glucosaminidase domain-containing protein -
  DQM80_RS06415 (NCTC8227_01288) - 1250554..1250739 (-) 186 WP_011054731.1 holin -
  DQM80_RS06420 (NCTC8227_01289) - 1250736..1251032 (-) 297 WP_011054732.1 hypothetical protein -
  DQM80_RS06425 (NCTC8227_01290) - 1251043..1251654 (-) 612 WP_011054733.1 DUF1366 domain-containing protein -
  DQM80_RS06430 (NCTC8227_01291) - 1251657..1252088 (-) 432 WP_002987513.1 DUF1617 family protein -
  DQM80_RS06435 (NCTC8227_01292) - 1252100..1253983 (-) 1884 WP_011054734.1 gp58-like family protein -
  DQM80_RS06440 (NCTC8227_01293) hylP 1253998..1255011 (-) 1014 WP_010922091.1 hyaluronidase HylP -
  DQM80_RS06445 (NCTC8227_01294) - 1255008..1257059 (-) 2052 WP_111702224.1 phage tail spike protein -
  DQM80_RS06450 (NCTC8227_01295) - 1257056..1257835 (-) 780 WP_011284845.1 distal tail protein Dit -
  DQM80_RS06455 (NCTC8227_01296) - 1257867..1261502 (-) 3636 WP_111702225.1 tape measure protein -
  DQM80_RS06460 (NCTC8227_01297) - 1261517..1261813 (-) 297 WP_021340179.1 hypothetical protein -
  DQM80_RS06465 (NCTC8227_01298) - 1261888..1262241 (-) 354 WP_002990023.1 tail assembly chaperone -
  DQM80_RS06470 (NCTC8227_01299) - 1262295..1262918 (-) 624 WP_030126608.1 phage major tail protein, TP901-1 family -
  DQM80_RS06475 (NCTC8227_01300) - 1262973..1263362 (-) 390 WP_011284850.1 hypothetical protein -
  DQM80_RS06480 (NCTC8227_01301) - 1263359..1263724 (-) 366 WP_030126607.1 HK97-gp10 family putative phage morphogenesis protein -
  DQM80_RS06485 (NCTC8227_01302) - 1263705..1264013 (-) 309 WP_011284852.1 hypothetical protein -
  DQM80_RS06490 (NCTC8227_01303) - 1264010..1264363 (-) 354 WP_002984392.1 phage head-tail connector protein -
  DQM80_RS06495 (NCTC8227_01304) - 1264377..1264619 (-) 243 WP_011284854.1 HeH/LEM domain-containing protein -
  DQM80_RS06500 (NCTC8227_01305) - 1264629..1265711 (-) 1083 WP_011284855.1 major capsid protein -
  DQM80_RS06505 (NCTC8227_01306) - 1265714..1266094 (-) 381 WP_011284856.1 head decoration protein -
  DQM80_RS06510 (NCTC8227_01307) - 1266104..1266637 (-) 534 WP_023079765.1 DUF4355 domain-containing protein -
  DQM80_RS06515 (NCTC8227_01308) - 1266781..1267047 (-) 267 WP_011284858.1 hypothetical protein -
  DQM80_RS06520 (NCTC8227_01309) - 1267050..1267364 (-) 315 WP_011284859.1 hypothetical protein -
  DQM80_RS06525 (NCTC8227_01310) - 1267434..1267619 (-) 186 WP_002988389.1 hypothetical protein -
  DQM80_RS06530 (NCTC8227_01311) - 1267623..1269185 (-) 1563 WP_012560958.1 phage head morphogenesis protein -
  DQM80_RS06535 (NCTC8227_01312) - 1269166..1270668 (-) 1503 WP_002984369.1 phage portal protein -
  DQM80_RS06540 (NCTC8227_01313) - 1270680..1271987 (-) 1308 WP_020833530.1 PBSX family phage terminase large subunit -
  DQM80_RS06545 (NCTC8227_01314) - 1271965..1272396 (-) 432 WP_020833531.1 terminase small subunit -
  DQM80_RS06550 (NCTC8227_01315) - 1272495..1272680 (+) 186 WP_001132273.1 type II toxin-antitoxin system HicA family toxin -
  DQM80_RS06555 (NCTC8227_01316) - 1272732..1273109 (+) 378 WP_002987543.1 type II toxin-antitoxin system HicB family antitoxin -
  DQM80_RS09430 - 1273404..1273637 (+) 234 WP_002995461.1 hypothetical protein -
  DQM80_RS06565 (NCTC8227_01318) - 1273727..1274641 (-) 915 WP_011284864.1 hypothetical protein -
  DQM80_RS06570 (NCTC8227_01319) - 1275116..1275550 (-) 435 WP_111702226.1 ArpU family phage packaging/lysis transcriptional regulator -
  DQM80_RS09435 (NCTC8227_01321) - 1276025..1276192 (-) 168 WP_172452975.1 hypothetical protein -
  DQM80_RS06575 (NCTC8227_01322) - 1276189..1276740 (-) 552 WP_111702227.1 DUF1642 domain-containing protein -
  DQM80_RS06580 (NCTC8227_01323) - 1276753..1277454 (-) 702 WP_231873495.1 DNA-methyltransferase -
  DQM80_RS06585 (NCTC8227_01324) - 1277458..1277742 (-) 285 WP_111702228.1 hypothetical protein -
  DQM80_RS06590 (NCTC8227_01325) - 1277739..1277915 (-) 177 WP_111702229.1 peptide chain release factor 2 -
  DQM80_RS06595 (NCTC8227_01326) - 1277929..1278198 (-) 270 WP_111702230.1 hypothetical protein -
  DQM80_RS06600 (NCTC8227_01327) - 1278195..1278479 (-) 285 WP_011054755.1 DUF3310 domain-containing protein -
  DQM80_RS06605 (NCTC8227_01328) - 1278473..1278724 (-) 252 WP_011054756.1 hypothetical protein -
  DQM80_RS06610 (NCTC8227_01329) - 1278721..1279077 (-) 357 WP_011054757.1 hypothetical protein -
  DQM80_RS06615 (NCTC8227_01330) - 1279074..1279514 (-) 441 WP_011054758.1 RusA family crossover junction endodeoxyribonuclease -
  DQM80_RS06620 - 1279514..1279717 (-) 204 WP_011106686.1 hypothetical protein -
  DQM80_RS06625 (NCTC8227_01331) ssbA 1279723..1280142 (-) 420 WP_032464069.1 single-stranded DNA-binding protein Machinery gene
  DQM80_RS06630 (NCTC8227_01332) - 1280135..1280809 (-) 675 WP_011054760.1 ERF family protein -
  DQM80_RS06635 (NCTC8227_01333) - 1280810..1281292 (-) 483 WP_011018142.1 siphovirus Gp157 family protein -
  DQM80_RS06640 (NCTC8227_01334) - 1281314..1281568 (-) 255 WP_011018143.1 hypothetical protein -
  DQM80_RS06645 (NCTC8227_01335) - 1281549..1281839 (-) 291 WP_014635612.1 hypothetical protein -
  DQM80_RS06650 (NCTC8227_01337) - 1282043..1282825 (-) 783 WP_011888684.1 ATP-binding protein -
  DQM80_RS06655 (NCTC8227_01338) - 1282812..1283615 (-) 804 WP_021340639.1 DnaD domain protein -
  DQM80_RS06660 (NCTC8227_01339) - 1283731..1284174 (-) 444 WP_012560973.1 hypothetical protein -
  DQM80_RS06665 (NCTC8227_01340) - 1284230..1284610 (+) 381 WP_000568478.1 hypothetical protein -
  DQM80_RS06670 (NCTC8227_01341) - 1284600..1284872 (-) 273 WP_000370473.1 hypothetical protein -
  DQM80_RS06675 (NCTC8227_01342) - 1285045..1285224 (-) 180 WP_012560974.1 hypothetical protein -
  DQM80_RS09595 (NCTC8227_01343) - 1285355..1285489 (-) 135 WP_012560975.1 hypothetical protein -
  DQM80_RS06680 (NCTC8227_01344) - 1285520..1285771 (-) 252 WP_023611247.1 helix-turn-helix transcriptional regulator -
  DQM80_RS06685 (NCTC8227_01345) - 1285871..1286089 (-) 219 WP_023612341.1 helix-turn-helix domain-containing protein -
  DQM80_RS06690 (NCTC8227_01346) - 1286277..1286636 (+) 360 WP_023611288.1 helix-turn-helix domain-containing protein -
  DQM80_RS06695 (NCTC8227_01347) - 1286620..1286997 (+) 378 WP_032467159.1 ImmA/IrrE family metallo-endopeptidase -
  DQM80_RS06700 (NCTC8227_01348) - 1287023..1288321 (+) 1299 WP_023611231.1 DUF4041 domain-containing protein -
  DQM80_RS06710 (NCTC8227_01349) - 1288502..1289668 (+) 1167 WP_011018152.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6976.99 Da        Isoelectric Point: 4.2550

>NTDB_id=1140240 DQM80_RS06385 WP_011184907.1 1245747..1245929(-) (prx) [Streptococcus pyogenes strain NCTC8227]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=1140240 DQM80_RS06385 WP_011184907.1 1245747..1245929(-) (prx) [Streptococcus pyogenes strain NCTC8227]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

85

100

0.85

  prx Streptococcus pyogenes MGAS8232

85

100

0.85

  prx Streptococcus pyogenes MGAS315

85

100

0.85

  prx Streptococcus pyogenes MGAS315

83.333

100

0.833

  prx Streptococcus pyogenes MGAS315

80

100

0.8

  prx Streptococcus pyogenes MGAS315

88.372

71.667

0.633

  prx Streptococcus pyogenes MGAS315

78.571

70

0.55


Multiple sequence alignment