Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM80_RS06385 | Genome accession | NZ_LS483399 |
| Coordinates | 1245747..1245929 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8227 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1245747..1289668 | 1245747..1245929 | within | 0 |
Gene organization within MGE regions
Location: 1245747..1289668
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM80_RS06385 (NCTC8227_01281) | prx | 1245747..1245929 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| DQM80_RS06390 (NCTC8227_01282) | sda3 | 1246167..1246967 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQM80_RS06395 (NCTC8227_01283) | - | 1247239..1247673 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQM80_RS06400 (NCTC8227_01284) | - | 1247723..1248589 (-) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| DQM80_RS06405 (NCTC8227_01285) | - | 1248577..1249101 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQM80_RS06410 (NCTC8227_01286) | - | 1249241..1250443 (-) | 1203 | WP_111702223.1 | glucosaminidase domain-containing protein | - |
| DQM80_RS06415 (NCTC8227_01288) | - | 1250554..1250739 (-) | 186 | WP_011054731.1 | holin | - |
| DQM80_RS06420 (NCTC8227_01289) | - | 1250736..1251032 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| DQM80_RS06425 (NCTC8227_01290) | - | 1251043..1251654 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| DQM80_RS06430 (NCTC8227_01291) | - | 1251657..1252088 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQM80_RS06435 (NCTC8227_01292) | - | 1252100..1253983 (-) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| DQM80_RS06440 (NCTC8227_01293) | hylP | 1253998..1255011 (-) | 1014 | WP_010922091.1 | hyaluronidase HylP | - |
| DQM80_RS06445 (NCTC8227_01294) | - | 1255008..1257059 (-) | 2052 | WP_111702224.1 | phage tail spike protein | - |
| DQM80_RS06450 (NCTC8227_01295) | - | 1257056..1257835 (-) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DQM80_RS06455 (NCTC8227_01296) | - | 1257867..1261502 (-) | 3636 | WP_111702225.1 | tape measure protein | - |
| DQM80_RS06460 (NCTC8227_01297) | - | 1261517..1261813 (-) | 297 | WP_021340179.1 | hypothetical protein | - |
| DQM80_RS06465 (NCTC8227_01298) | - | 1261888..1262241 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DQM80_RS06470 (NCTC8227_01299) | - | 1262295..1262918 (-) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DQM80_RS06475 (NCTC8227_01300) | - | 1262973..1263362 (-) | 390 | WP_011284850.1 | hypothetical protein | - |
| DQM80_RS06480 (NCTC8227_01301) | - | 1263359..1263724 (-) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM80_RS06485 (NCTC8227_01302) | - | 1263705..1264013 (-) | 309 | WP_011284852.1 | hypothetical protein | - |
| DQM80_RS06490 (NCTC8227_01303) | - | 1264010..1264363 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DQM80_RS06495 (NCTC8227_01304) | - | 1264377..1264619 (-) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DQM80_RS06500 (NCTC8227_01305) | - | 1264629..1265711 (-) | 1083 | WP_011284855.1 | major capsid protein | - |
| DQM80_RS06505 (NCTC8227_01306) | - | 1265714..1266094 (-) | 381 | WP_011284856.1 | head decoration protein | - |
| DQM80_RS06510 (NCTC8227_01307) | - | 1266104..1266637 (-) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DQM80_RS06515 (NCTC8227_01308) | - | 1266781..1267047 (-) | 267 | WP_011284858.1 | hypothetical protein | - |
| DQM80_RS06520 (NCTC8227_01309) | - | 1267050..1267364 (-) | 315 | WP_011284859.1 | hypothetical protein | - |
| DQM80_RS06525 (NCTC8227_01310) | - | 1267434..1267619 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| DQM80_RS06530 (NCTC8227_01311) | - | 1267623..1269185 (-) | 1563 | WP_012560958.1 | phage head morphogenesis protein | - |
| DQM80_RS06535 (NCTC8227_01312) | - | 1269166..1270668 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| DQM80_RS06540 (NCTC8227_01313) | - | 1270680..1271987 (-) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DQM80_RS06545 (NCTC8227_01314) | - | 1271965..1272396 (-) | 432 | WP_020833531.1 | terminase small subunit | - |
| DQM80_RS06550 (NCTC8227_01315) | - | 1272495..1272680 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DQM80_RS06555 (NCTC8227_01316) | - | 1272732..1273109 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DQM80_RS09430 | - | 1273404..1273637 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| DQM80_RS06565 (NCTC8227_01318) | - | 1273727..1274641 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| DQM80_RS06570 (NCTC8227_01319) | - | 1275116..1275550 (-) | 435 | WP_111702226.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM80_RS09435 (NCTC8227_01321) | - | 1276025..1276192 (-) | 168 | WP_172452975.1 | hypothetical protein | - |
| DQM80_RS06575 (NCTC8227_01322) | - | 1276189..1276740 (-) | 552 | WP_111702227.1 | DUF1642 domain-containing protein | - |
| DQM80_RS06580 (NCTC8227_01323) | - | 1276753..1277454 (-) | 702 | WP_231873495.1 | DNA-methyltransferase | - |
| DQM80_RS06585 (NCTC8227_01324) | - | 1277458..1277742 (-) | 285 | WP_111702228.1 | hypothetical protein | - |
| DQM80_RS06590 (NCTC8227_01325) | - | 1277739..1277915 (-) | 177 | WP_111702229.1 | peptide chain release factor 2 | - |
| DQM80_RS06595 (NCTC8227_01326) | - | 1277929..1278198 (-) | 270 | WP_111702230.1 | hypothetical protein | - |
| DQM80_RS06600 (NCTC8227_01327) | - | 1278195..1278479 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DQM80_RS06605 (NCTC8227_01328) | - | 1278473..1278724 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| DQM80_RS06610 (NCTC8227_01329) | - | 1278721..1279077 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| DQM80_RS06615 (NCTC8227_01330) | - | 1279074..1279514 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQM80_RS06620 | - | 1279514..1279717 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQM80_RS06625 (NCTC8227_01331) | ssbA | 1279723..1280142 (-) | 420 | WP_032464069.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM80_RS06630 (NCTC8227_01332) | - | 1280135..1280809 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| DQM80_RS06635 (NCTC8227_01333) | - | 1280810..1281292 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQM80_RS06640 (NCTC8227_01334) | - | 1281314..1281568 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| DQM80_RS06645 (NCTC8227_01335) | - | 1281549..1281839 (-) | 291 | WP_014635612.1 | hypothetical protein | - |
| DQM80_RS06650 (NCTC8227_01337) | - | 1282043..1282825 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| DQM80_RS06655 (NCTC8227_01338) | - | 1282812..1283615 (-) | 804 | WP_021340639.1 | DnaD domain protein | - |
| DQM80_RS06660 (NCTC8227_01339) | - | 1283731..1284174 (-) | 444 | WP_012560973.1 | hypothetical protein | - |
| DQM80_RS06665 (NCTC8227_01340) | - | 1284230..1284610 (+) | 381 | WP_000568478.1 | hypothetical protein | - |
| DQM80_RS06670 (NCTC8227_01341) | - | 1284600..1284872 (-) | 273 | WP_000370473.1 | hypothetical protein | - |
| DQM80_RS06675 (NCTC8227_01342) | - | 1285045..1285224 (-) | 180 | WP_012560974.1 | hypothetical protein | - |
| DQM80_RS09595 (NCTC8227_01343) | - | 1285355..1285489 (-) | 135 | WP_012560975.1 | hypothetical protein | - |
| DQM80_RS06680 (NCTC8227_01344) | - | 1285520..1285771 (-) | 252 | WP_023611247.1 | helix-turn-helix transcriptional regulator | - |
| DQM80_RS06685 (NCTC8227_01345) | - | 1285871..1286089 (-) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| DQM80_RS06690 (NCTC8227_01346) | - | 1286277..1286636 (+) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| DQM80_RS06695 (NCTC8227_01347) | - | 1286620..1286997 (+) | 378 | WP_032467159.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM80_RS06700 (NCTC8227_01348) | - | 1287023..1288321 (+) | 1299 | WP_023611231.1 | DUF4041 domain-containing protein | - |
| DQM80_RS06710 (NCTC8227_01349) | - | 1288502..1289668 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=1140240 DQM80_RS06385 WP_011184907.1 1245747..1245929(-) (prx) [Streptococcus pyogenes strain NCTC8227]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1140240 DQM80_RS06385 WP_011184907.1 1245747..1245929(-) (prx) [Streptococcus pyogenes strain NCTC8227]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |