Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM80_RS05655 | Genome accession | NZ_LS483399 |
| Coordinates | 1105193..1105375 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8227 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1105193..1146422 | 1105193..1105375 | within | 0 |
Gene organization within MGE regions
Location: 1105193..1146422
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM80_RS05655 (NCTC8227_01134) | prx | 1105193..1105375 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| DQM80_RS05660 (NCTC8227_01135) | mf2 | 1105615..1106373 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQM80_RS05665 (NCTC8227_01136) | speC | 1106484..1107191 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQM80_RS05670 (NCTC8227_01137) | - | 1107260..1108012 (-) | 753 | WP_023611694.1 | CHAP domain-containing protein | - |
| DQM80_RS05675 (NCTC8227_01138) | - | 1108014..1108346 (-) | 333 | WP_003052353.1 | phage holin | - |
| DQM80_RS05680 (NCTC8227_01139) | - | 1108348..1108677 (-) | 330 | WP_111694880.1 | hypothetical protein | - |
| DQM80_RS05685 (NCTC8227_01140) | - | 1108688..1109305 (-) | 618 | WP_111702187.1 | DUF1366 domain-containing protein | - |
| DQM80_RS05690 (NCTC8227_01141) | - | 1109308..1109739 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQM80_RS05695 (NCTC8227_01142) | - | 1109751..1111634 (-) | 1884 | WP_111674633.1 | gp58-like family protein | - |
| DQM80_RS05700 (NCTC8227_01143) | hylP | 1111649..1112668 (-) | 1020 | WP_111702188.1 | hyaluronidase HylP | - |
| DQM80_RS05705 (NCTC8227_01144) | - | 1112665..1114809 (-) | 2145 | WP_111674635.1 | phage tail spike protein | - |
| DQM80_RS05710 (NCTC8227_01145) | - | 1114806..1115522 (-) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| DQM80_RS05715 (NCTC8227_01146) | - | 1115519..1118779 (-) | 3261 | WP_111702189.1 | tape measure protein | - |
| DQM80_RS05720 (NCTC8227_01147) | - | 1118769..1119350 (-) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| DQM80_RS05725 (NCTC8227_01148) | - | 1119354..1119788 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| DQM80_RS05730 (NCTC8227_01149) | - | 1119827..1120312 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQM80_RS05735 (NCTC8227_01150) | - | 1120312..1120710 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQM80_RS05740 (NCTC8227_01151) | - | 1120707..1121063 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQM80_RS05745 (NCTC8227_01152) | - | 1121063..1121395 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQM80_RS05750 (NCTC8227_01153) | - | 1121385..1121801 (-) | 417 | WP_111674639.1 | hypothetical protein | - |
| DQM80_RS05755 (NCTC8227_01154) | - | 1121855..1122673 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQM80_RS05760 (NCTC8227_01155) | - | 1122677..1123291 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| DQM80_RS05765 (NCTC8227_01156) | - | 1123417..1123683 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| DQM80_RS05770 (NCTC8227_01157) | - | 1123770..1123997 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| DQM80_RS05775 (NCTC8227_01158) | - | 1123997..1125490 (-) | 1494 | WP_111674641.1 | phage minor capsid protein | - |
| DQM80_RS05780 (NCTC8227_01159) | - | 1125495..1126997 (-) | 1503 | WP_111674642.1 | phage portal protein | - |
| DQM80_RS05785 (NCTC8227_01160) | - | 1127011..1128302 (-) | 1292 | Protein_1091 | PBSX family phage terminase large subunit | - |
| DQM80_RS05790 (NCTC8227_01161) | terS | 1128305..1129000 (-) | 696 | WP_111674775.1 | phage terminase small subunit | - |
| DQM80_RS05795 (NCTC8227_01162) | - | 1129120..1129536 (-) | 417 | WP_111674644.1 | transcriptional regulator | - |
| DQM80_RS05800 (NCTC8227_01163) | - | 1129533..1129724 (-) | 192 | WP_023611036.1 | hypothetical protein | - |
| DQM80_RS09535 (NCTC8227_01164) | - | 1129728..1129980 (-) | 253 | Protein_1095 | hypothetical protein | - |
| DQM80_RS09420 (NCTC8227_01165) | - | 1129973..1130143 (-) | 171 | WP_023079587.1 | hypothetical protein | - |
| DQM80_RS05810 (NCTC8227_01166) | - | 1130144..1131466 (-) | 1323 | WP_047149508.1 | SNF2-related protein | - |
| DQM80_RS05815 (NCTC8227_01167) | - | 1131463..1131738 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQM80_RS05820 (NCTC8227_01168) | - | 1132124..1134508 (-) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| DQM80_RS05825 (NCTC8227_01169) | - | 1134513..1136435 (-) | 1923 | WP_111674645.1 | DNA polymerase | - |
| DQM80_RS05830 (NCTC8227_01170) | - | 1136478..1137041 (-) | 564 | WP_111674646.1 | DUF2815 family protein | - |
| DQM80_RS05835 (NCTC8227_01171) | - | 1137050..1138207 (-) | 1158 | WP_111674647.1 | DUF2800 domain-containing protein | - |
| DQM80_RS05840 (NCTC8227_01172) | - | 1138207..1138506 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| DQM80_RS05845 (NCTC8227_01173) | - | 1138595..1138798 (-) | 204 | WP_023611025.1 | hypothetical protein | - |
| DQM80_RS05850 (NCTC8227_01175) | - | 1139288..1139673 (-) | 386 | Protein_1105 | hypothetical protein | - |
| DQM80_RS05855 (NCTC8227_01176) | - | 1139670..1139873 (-) | 204 | WP_023611032.1 | hypothetical protein | - |
| DQM80_RS05860 (NCTC8227_01177) | - | 1139866..1140036 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQM80_RS05865 (NCTC8227_01178) | - | 1140038..1140349 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQM80_RS05870 (NCTC8227_01179) | - | 1140456..1140671 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| DQM80_RS05875 (NCTC8227_01180) | - | 1140645..1140893 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| DQM80_RS05880 (NCTC8227_01181) | - | 1140973..1141182 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| DQM80_RS05885 (NCTC8227_01182) | - | 1141324..1141584 (+) | 261 | WP_023611024.1 | hypothetical protein | - |
| DQM80_RS05890 (NCTC8227_01184) | - | 1141683..1142420 (-) | 738 | WP_023611022.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM80_RS05895 (NCTC8227_01185) | - | 1142432..1142623 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQM80_RS05900 | - | 1143259..1143354 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQM80_RS05905 (NCTC8227_01187) | - | 1143777..1144124 (+) | 348 | WP_002994741.1 | helix-turn-helix domain-containing protein | - |
| DQM80_RS05910 (NCTC8227_01188) | - | 1144128..1144508 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM80_RS05915 (NCTC8227_01189) | - | 1144520..1144786 (+) | 267 | WP_076634078.1 | DUF4177 domain-containing protein | - |
| DQM80_RS05920 (NCTC8227_01190) | - | 1144915..1146057 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM80_RS05925 (NCTC8227_01191) | - | 1146147..1146422 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=1140237 DQM80_RS05655 WP_011184726.1 1105193..1105375(-) (prx) [Streptococcus pyogenes strain NCTC8227]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1140237 DQM80_RS05655 WP_011184726.1 1105193..1105375(-) (prx) [Streptococcus pyogenes strain NCTC8227]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |