Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM80_RS04800 | Genome accession | NZ_LS483399 |
| Coordinates | 942953..943141 (-) | Length | 62 a.a. |
| NCBI ID | WP_111702135.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8227 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 935369..987099 | 942953..943141 | within | 0 |
Gene organization within MGE regions
Location: 935369..987099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM80_RS04765 (NCTC8227_00947) | pfkA | 935369..936382 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| DQM80_RS04770 (NCTC8227_00948) | - | 936462..939572 (-) | 3111 | WP_111702133.1 | DNA polymerase III subunit alpha | - |
| DQM80_RS04775 (NCTC8227_00949) | - | 939757..940128 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DQM80_RS04780 (NCTC8227_00950) | - | 940128..940826 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQM80_RS04785 (NCTC8227_00951) | - | 940836..941621 (+) | 786 | WP_111702134.1 | ABC transporter permease | - |
| DQM80_RS04790 (NCTC8227_00952) | - | 941748..942362 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM80_RS04800 (NCTC8227_00954) | prx | 942953..943141 (-) | 189 | WP_111702135.1 | Paratox | Regulator |
| DQM80_RS04805 (NCTC8227_00955) | sda3 | 943380..944180 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQM80_RS04810 (NCTC8227_00956) | - | 944451..944885 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQM80_RS04815 (NCTC8227_00957) | - | 944953..945594 (-) | 642 | Protein_898 | CHAP domain-containing protein | - |
| DQM80_RS04820 (NCTC8227_00958) | - | 945756..946400 (-) | 645 | WP_231873493.1 | AP2 domain-containing protein | - |
| DQM80_RS04825 (NCTC8227_00959) | - | 946636..947190 (-) | 555 | Protein_900 | glycoside hydrolase family 73 protein | - |
| DQM80_RS04830 (NCTC8227_00960) | - | 947306..947533 (-) | 228 | WP_000609113.1 | phage holin | - |
| DQM80_RS04835 (NCTC8227_00961) | - | 947530..947802 (-) | 273 | WP_023610930.1 | hypothetical protein | - |
| DQM80_RS04840 (NCTC8227_00962) | - | 947812..948429 (-) | 618 | WP_020833519.1 | DUF1366 domain-containing protein | - |
| DQM80_RS04845 (NCTC8227_00963) | - | 948432..948863 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQM80_RS04850 (NCTC8227_00964) | - | 948875..950890 (-) | 2016 | WP_111702138.1 | gp58-like family protein | - |
| DQM80_RS04855 (NCTC8227_00965) | hylP | 950903..951928 (-) | 1026 | WP_030127700.1 | hyaluronidase HylP | - |
| DQM80_RS04860 (NCTC8227_00966) | - | 951925..954072 (-) | 2148 | WP_111702139.1 | phage tail spike protein | - |
| DQM80_RS04865 (NCTC8227_00967) | - | 954069..954776 (-) | 708 | WP_109820925.1 | distal tail protein Dit | - |
| DQM80_RS04870 (NCTC8227_00968) | - | 954776..958699 (-) | 3924 | WP_111702140.1 | phage tail tape measure protein | - |
| DQM80_RS09395 (NCTC8227_00969) | - | 958712..958876 (-) | 165 | WP_168625219.1 | hypothetical protein | - |
| DQM80_RS04875 (NCTC8227_00970) | gpG | 958908..959234 (-) | 327 | WP_021733367.1 | phage tail assembly chaperone G | - |
| DQM80_RS04880 (NCTC8227_00971) | - | 959287..959898 (-) | 612 | WP_111702371.1 | major tail protein | - |
| DQM80_RS04885 (NCTC8227_00972) | - | 959915..960340 (-) | 426 | WP_003055350.1 | hypothetical protein | - |
| DQM80_RS04890 (NCTC8227_00973) | - | 960337..960714 (-) | 378 | WP_003055321.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM80_RS04895 (NCTC8227_00974) | - | 960711..961058 (-) | 348 | WP_003055344.1 | phage head closure protein | - |
| DQM80_RS04900 (NCTC8227_00975) | - | 961055..961357 (-) | 303 | WP_109820928.1 | head-tail connector protein | - |
| DQM80_RS09575 | - | 961360..961488 (-) | 129 | WP_265415937.1 | hypothetical protein | - |
| DQM80_RS04905 (NCTC8227_00976) | - | 961535..962722 (-) | 1188 | WP_109820929.1 | phage major capsid protein | - |
| DQM80_RS04910 (NCTC8227_00977) | - | 962747..963412 (-) | 666 | WP_109820930.1 | head maturation protease, ClpP-related | - |
| DQM80_RS04915 (NCTC8227_00978) | - | 963390..964610 (-) | 1221 | WP_109820931.1 | phage portal protein | - |
| DQM80_RS04920 (NCTC8227_00979) | - | 964679..965422 (-) | 744 | WP_111702141.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM80_RS04925 (NCTC8227_00980) | - | 965424..965672 (-) | 249 | WP_002984380.1 | hypothetical protein | - |
| DQM80_RS04930 (NCTC8227_00981) | - | 965787..965966 (-) | 180 | WP_011017861.1 | hypothetical protein | - |
| DQM80_RS04935 (NCTC8227_00982) | - | 966051..966320 (-) | 270 | WP_002984375.1 | hypothetical protein | - |
| DQM80_RS09405 (NCTC8227_00983) | - | 966313..966483 (-) | 171 | WP_168388874.1 | hypothetical protein | - |
| DQM80_RS04940 (NCTC8227_00984) | - | 966480..968234 (-) | 1755 | WP_111702142.1 | terminase large subunit | - |
| DQM80_RS04945 (NCTC8227_00985) | - | 968249..968716 (-) | 468 | WP_109820934.1 | phage terminase small subunit P27 family | - |
| DQM80_RS04950 (NCTC8227_00986) | - | 968888..969226 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQM80_RS04960 (NCTC8227_00987) | - | 969773..970207 (-) | 435 | WP_111702143.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM80_RS04965 (NCTC8227_00988) | - | 970232..970660 (-) | 429 | WP_111702144.1 | DUF1642 domain-containing protein | - |
| DQM80_RS04970 (NCTC8227_00989) | - | 970663..971295 (-) | 633 | WP_111702145.1 | N-6 DNA methylase | - |
| DQM80_RS04975 (NCTC8227_00990) | - | 971297..971581 (-) | 285 | WP_111702146.1 | hypothetical protein | - |
| DQM80_RS04980 (NCTC8227_00991) | - | 971578..971991 (-) | 414 | WP_111702147.1 | YopX family protein | - |
| DQM80_RS04985 (NCTC8227_00992) | - | 971988..972272 (-) | 285 | WP_111702148.1 | DUF3310 domain-containing protein | - |
| DQM80_RS09620 (NCTC8227_00993) | - | 972266..972517 (-) | 252 | WP_111702149.1 | hypothetical protein | - |
| DQM80_RS04995 (NCTC8227_00994) | - | 972514..972870 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQM80_RS05000 (NCTC8227_00995) | - | 972854..973138 (-) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DQM80_RS05005 (NCTC8227_00996) | - | 973158..974027 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DQM80_RS05010 (NCTC8227_00997) | - | 974296..975849 (-) | 1554 | WP_011017876.1 | hypothetical protein | - |
| DQM80_RS05015 (NCTC8227_00998) | - | 975867..976349 (-) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| DQM80_RS05020 (NCTC8227_00999) | - | 976354..977787 (-) | 1434 | Protein_941 | DEAD/DEAH box helicase | - |
| DQM80_RS05025 (NCTC8227_01000) | - | 977793..978476 (-) | 684 | WP_111702151.1 | AAA family ATPase | - |
| DQM80_RS05030 (NCTC8227_01001) | - | 978473..978757 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| DQM80_RS05035 (NCTC8227_01002) | - | 978754..978948 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQM80_RS05040 (NCTC8227_01003) | - | 978948..979277 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| DQM80_RS05045 (NCTC8227_01005) | - | 979358..979495 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| DQM80_RS05050 (NCTC8227_01006) | - | 979492..979788 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQM80_RS05055 (NCTC8227_01007) | - | 979867..980052 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM80_RS05060 (NCTC8227_01008) | - | 980219..980458 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQM80_RS05065 (NCTC8227_01009) | - | 980607..980831 (+) | 225 | WP_111702152.1 | hypothetical protein | - |
| DQM80_RS05070 (NCTC8227_01011) | - | 980999..981199 (-) | 201 | WP_038433319.1 | helix-turn-helix domain-containing protein | - |
| DQM80_RS05075 (NCTC8227_01012) | - | 981296..982075 (+) | 780 | WP_111702153.1 | hypothetical protein | - |
| DQM80_RS05080 (NCTC8227_01014) | - | 982209..982367 (-) | 159 | WP_111702154.1 | hypothetical protein | - |
| DQM80_RS05085 (NCTC8227_01015) | - | 982426..982641 (+) | 216 | WP_014635530.1 | hypothetical protein | - |
| DQM80_RS05090 (NCTC8227_01017) | - | 983132..983956 (+) | 825 | WP_038433318.1 | XRE family transcriptional regulator | - |
| DQM80_RS05095 (NCTC8227_01018) | - | 983969..984778 (+) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM80_RS05100 (NCTC8227_01020) | - | 985028..986116 (+) | 1089 | WP_011017891.1 | site-specific integrase | - |
| DQM80_RS05105 (NCTC8227_01021) | - | 986479..987099 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.30 Da Isoelectric Point: 4.2550
>NTDB_id=1140234 DQM80_RS04800 WP_111702135.1 942953..943141(-) (prx) [Streptococcus pyogenes strain NCTC8227]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1140234 DQM80_RS04800 WP_111702135.1 942953..943141(-) (prx) [Streptococcus pyogenes strain NCTC8227]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90.323 |
100 |
0.903 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
83.051 |
95.161 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
95.161 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
67.742 |
0.532 |