Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM37_RS05600 | Genome accession | NZ_LS483394 |
| Coordinates | 1107769..1107951 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC10880 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1107769..1149262 | 1107769..1107951 | within | 0 |
Gene organization within MGE regions
Location: 1107769..1149262
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM37_RS05600 (NCTC10880_01121) | prx | 1107769..1107951 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| DQM37_RS05605 (NCTC10880_01122) | mf2 | 1108191..1108949 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQM37_RS05610 (NCTC10880_01123) | speC | 1109060..1109767 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQM37_RS05615 (NCTC10880_01124) | - | 1109836..1110588 (-) | 753 | WP_023611694.1 | CHAP domain-containing protein | - |
| DQM37_RS05620 (NCTC10880_01125) | - | 1110590..1110922 (-) | 333 | WP_003052353.1 | phage holin | - |
| DQM37_RS05625 (NCTC10880_01126) | - | 1110924..1111253 (-) | 330 | WP_111694880.1 | hypothetical protein | - |
| DQM37_RS05630 (NCTC10880_01127) | - | 1111264..1111875 (-) | 612 | WP_111694881.1 | DUF1366 domain-containing protein | - |
| DQM37_RS05635 (NCTC10880_01128) | - | 1111878..1112306 (-) | 429 | WP_111694882.1 | DUF1617 family protein | - |
| DQM37_RS05640 (NCTC10880_01129) | - | 1112315..1114138 (-) | 1824 | WP_111694883.1 | gp58-like family protein | - |
| DQM37_RS05645 (NCTC10880_01130) | - | 1114149..1114463 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| DQM37_RS05650 (NCTC10880_01131) | - | 1114465..1115688 (-) | 1224 | WP_030127718.1 | hypothetical protein | - |
| DQM37_RS05655 (NCTC10880_01132) | - | 1115685..1117832 (-) | 2148 | WP_111694884.1 | phage tail spike protein | - |
| DQM37_RS05660 (NCTC10880_01133) | - | 1117829..1118545 (-) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| DQM37_RS05665 (NCTC10880_01134) | - | 1118542..1121802 (-) | 3261 | WP_111694885.1 | tape measure protein | - |
| DQM37_RS05670 (NCTC10880_01135) | - | 1121792..1122373 (-) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| DQM37_RS05675 (NCTC10880_01136) | - | 1122377..1122811 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| DQM37_RS05680 (NCTC10880_01137) | - | 1122850..1123335 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQM37_RS05685 (NCTC10880_01138) | - | 1123335..1123733 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQM37_RS05690 (NCTC10880_01139) | - | 1123730..1124086 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQM37_RS05695 (NCTC10880_01140) | - | 1124086..1124418 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQM37_RS05700 (NCTC10880_01141) | - | 1124408..1124824 (-) | 417 | WP_111694886.1 | hypothetical protein | - |
| DQM37_RS05705 (NCTC10880_01142) | - | 1124878..1125696 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQM37_RS05710 (NCTC10880_01143) | - | 1125700..1126314 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| DQM37_RS05715 (NCTC10880_01144) | - | 1126440..1126706 (-) | 267 | WP_111694887.1 | hypothetical protein | - |
| DQM37_RS05720 (NCTC10880_01145) | - | 1126768..1127007 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQM37_RS05725 (NCTC10880_01146) | - | 1126979..1128457 (-) | 1479 | WP_111694888.1 | phage minor capsid protein | - |
| DQM37_RS05730 (NCTC10880_01147) | - | 1128462..1129964 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| DQM37_RS05735 (NCTC10880_01148) | - | 1129978..1131261 (-) | 1284 | WP_172451596.1 | PBSX family phage terminase large subunit | - |
| DQM37_RS05740 (NCTC10880_01149) | terS | 1131254..1131949 (-) | 696 | WP_050318691.1 | phage terminase small subunit | - |
| DQM37_RS05745 (NCTC10880_01150) | - | 1132069..1132485 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQM37_RS05750 (NCTC10880_01152) | - | 1132618..1132890 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQM37_RS09090 (NCTC10880_01153) | - | 1132883..1133053 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| DQM37_RS05755 (NCTC10880_01154) | - | 1133054..1134376 (-) | 1323 | WP_111694889.1 | SNF2-related protein | - |
| DQM37_RS05760 (NCTC10880_01155) | - | 1134373..1134648 (-) | 276 | WP_050320439.1 | VRR-NUC domain-containing protein | - |
| DQM37_RS05765 (NCTC10880_01156) | - | 1135034..1137418 (-) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| DQM37_RS05770 (NCTC10880_01157) | - | 1137423..1139345 (-) | 1923 | WP_111674645.1 | DNA polymerase | - |
| DQM37_RS05775 (NCTC10880_01158) | - | 1139388..1139951 (-) | 564 | WP_111674646.1 | DUF2815 family protein | - |
| DQM37_RS05780 (NCTC10880_01159) | - | 1139960..1141117 (-) | 1158 | WP_023611034.1 | DUF2800 domain-containing protein | - |
| DQM37_RS05785 (NCTC10880_01160) | - | 1141117..1141416 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| DQM37_RS05790 (NCTC10880_01161) | - | 1141505..1141708 (-) | 204 | WP_023611025.1 | hypothetical protein | - |
| DQM37_RS05795 (NCTC10880_01163) | - | 1142198..1142584 (-) | 387 | WP_111694890.1 | hypothetical protein | - |
| DQM37_RS09290 (NCTC10880_01164) | - | 1142581..1142797 (-) | 217 | Protein_1075 | hypothetical protein | - |
| DQM37_RS05805 (NCTC10880_01165) | - | 1142790..1142960 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQM37_RS05810 (NCTC10880_01166) | - | 1142962..1143273 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQM37_RS05815 (NCTC10880_01167) | - | 1143380..1143595 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| DQM37_RS05820 (NCTC10880_01168) | - | 1143569..1143817 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| DQM37_RS05825 (NCTC10880_01169) | - | 1143897..1144106 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| DQM37_RS05830 (NCTC10880_01170) | - | 1144248..1144508 (+) | 261 | WP_023611024.1 | hypothetical protein | - |
| DQM37_RS05835 (NCTC10880_01172) | - | 1144607..1145260 (-) | 654 | WP_111688314.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM37_RS05840 (NCTC10880_01173) | - | 1145272..1145463 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQM37_RS05845 | - | 1146099..1146194 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQM37_RS05850 (NCTC10880_01175) | - | 1146617..1146964 (+) | 348 | WP_111688316.1 | helix-turn-helix domain-containing protein | - |
| DQM37_RS05855 (NCTC10880_01176) | - | 1146968..1147348 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM37_RS05860 (NCTC10880_01177) | - | 1147360..1147626 (+) | 267 | WP_076634078.1 | DUF4177 domain-containing protein | - |
| DQM37_RS05865 (NCTC10880_01178) | - | 1147755..1148897 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM37_RS05870 (NCTC10880_01179) | - | 1148987..1149262 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=1140101 DQM37_RS05600 WP_011184726.1 1107769..1107951(-) (prx) [Streptococcus pyogenes strain NCTC10880]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1140101 DQM37_RS05600 WP_011184726.1 1107769..1107951(-) (prx) [Streptococcus pyogenes strain NCTC10880]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |