Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQN61_RS07525 | Genome accession | NZ_LS483391 |
| Coordinates | 1418398..1418580 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8320 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1415983..1459928 | 1418398..1418580 | within | 0 |
Gene organization within MGE regions
Location: 1415983..1459928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN61_RS07515 (NCTC8320_01504) | tsaE | 1415983..1416444 (-) | 462 | WP_002983367.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| DQN61_RS07520 (NCTC8320_01505) | - | 1416598..1418058 (-) | 1461 | WP_011018103.1 | NCS2 family permease | - |
| DQN61_RS07525 (NCTC8320_01506) | prx | 1418398..1418580 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| DQN61_RS07530 (NCTC8320_01507) | sda | 1418820..1419818 (+) | 999 | WP_011018105.1 | streptodornase A | - |
| DQN61_RS07535 (NCTC8320_01508) | - | 1419959..1420552 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| DQN61_RS07540 (NCTC8320_01509) | - | 1420552..1420716 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| DQN61_RS07545 (NCTC8320_01510) | - | 1420865..1422070 (-) | 1206 | WP_011018108.1 | glucosaminidase domain-containing protein | - |
| DQN61_RS07550 (NCTC8320_01512) | - | 1422183..1422377 (-) | 195 | WP_023079604.1 | hypothetical protein | - |
| DQN61_RS07555 (NCTC8320_01513) | - | 1422374..1422673 (-) | 300 | WP_011018110.1 | hypothetical protein | - |
| DQN61_RS07560 (NCTC8320_01514) | - | 1422684..1423301 (-) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| DQN61_RS07565 (NCTC8320_01515) | - | 1423304..1423732 (-) | 429 | WP_011018112.1 | DUF1617 family protein | - |
| DQN61_RS07570 (NCTC8320_01516) | - | 1423744..1425759 (-) | 2016 | WP_011018113.1 | gp58-like family protein | - |
| DQN61_RS07575 (NCTC8320_01517) | - | 1425774..1426883 (-) | 1110 | WP_023079600.1 | hyaluronidase HylP | - |
| DQN61_RS07580 (NCTC8320_01518) | - | 1426883..1428862 (-) | 1980 | WP_041174241.1 | phage tail spike protein | - |
| DQN61_RS10170 (NCTC8320_01519) | - | 1428870..1429028 (-) | 159 | WP_011018115.1 | hypothetical protein | - |
| DQN61_RS07585 (NCTC8320_01520) | - | 1429025..1429741 (-) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| DQN61_RS07590 (NCTC8320_01521) | - | 1429738..1432998 (-) | 3261 | WP_072135770.1 | tape measure protein | - |
| DQN61_RS07595 (NCTC8320_01522) | - | 1432988..1433569 (-) | 582 | WP_011018118.1 | bacteriophage Gp15 family protein | - |
| DQN61_RS07600 (NCTC8320_01523) | - | 1433573..1434007 (-) | 435 | WP_011018119.1 | hypothetical protein | - |
| DQN61_RS07605 (NCTC8320_01524) | - | 1434051..1434512 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| DQN61_RS07610 (NCTC8320_01525) | - | 1434512..1434910 (-) | 399 | WP_011018121.1 | minor capsid protein | - |
| DQN61_RS07615 (NCTC8320_01526) | - | 1434907..1435263 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQN61_RS07620 (NCTC8320_01527) | - | 1435263..1435595 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQN61_RS07625 (NCTC8320_01528) | - | 1435585..1436001 (-) | 417 | WP_011018123.1 | hypothetical protein | - |
| DQN61_RS07630 (NCTC8320_01529) | - | 1436055..1436873 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQN61_RS07635 (NCTC8320_01530) | - | 1436877..1437491 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| DQN61_RS07640 (NCTC8320_01531) | - | 1437617..1437883 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| DQN61_RS07645 (NCTC8320_01532) | - | 1437970..1438197 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| DQN61_RS07650 (NCTC8320_01533) | - | 1438197..1439690 (-) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| DQN61_RS07655 (NCTC8320_01534) | - | 1439695..1441197 (-) | 1503 | WP_072135769.1 | phage portal protein | - |
| DQN61_RS07660 (NCTC8320_01535) | - | 1441211..1442502 (-) | 1292 | Protein_1429 | PBSX family phage terminase large subunit | - |
| DQN61_RS07665 (NCTC8320_01536) | - | 1442505..1442978 (-) | 474 | WP_011018127.1 | hypothetical protein | - |
| DQN61_RS07670 (NCTC8320_01537) | - | 1443029..1443406 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DQN61_RS07675 | - | 1443467..1443943 (-) | 477 | WP_174148345.1 | GNAT family N-acetyltransferase | - |
| DQN61_RS07680 (NCTC8320_01538) | - | 1443859..1444536 (-) | 678 | WP_011018129.1 | ABC transporter ATP-binding protein | - |
| DQN61_RS07685 (NCTC8320_01539) | - | 1444515..1445033 (-) | 519 | WP_011018130.1 | ParB N-terminal domain-containing protein | - |
| DQN61_RS07695 (NCTC8320_01540) | - | 1445497..1445937 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQN61_RS07700 (NCTC8320_01541) | - | 1446211..1446477 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| DQN61_RS07705 (NCTC8320_01542) | - | 1446474..1446845 (-) | 372 | WP_011018132.1 | DUF1642 domain-containing protein | - |
| DQN61_RS07710 (NCTC8320_01543) | - | 1446966..1447598 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQN61_RS07715 (NCTC8320_01544) | - | 1447600..1447884 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| DQN61_RS09825 (NCTC8320_01545) | - | 1447895..1448065 (-) | 171 | WP_011018135.1 | hypothetical protein | - |
| DQN61_RS07720 (NCTC8320_01546) | - | 1448062..1448466 (-) | 405 | WP_011018136.1 | YopX family protein | - |
| DQN61_RS07725 (NCTC8320_01547) | - | 1448463..1448747 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| DQN61_RS10100 (NCTC8320_01548) | - | 1448741..1448992 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| DQN61_RS07735 (NCTC8320_01549) | - | 1448989..1449345 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQN61_RS07740 (NCTC8320_01550) | - | 1449342..1449782 (-) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQN61_RS07745 | - | 1449782..1449985 (-) | 204 | WP_032465709.1 | hypothetical protein | - |
| DQN61_RS07750 (NCTC8320_01551) | ssbA | 1449991..1450410 (-) | 420 | WP_011018140.1 | single-stranded DNA-binding protein | Machinery gene |
| DQN61_RS07755 (NCTC8320_01552) | - | 1450403..1451077 (-) | 675 | WP_011018141.1 | ERF family protein | - |
| DQN61_RS07760 (NCTC8320_01553) | - | 1451078..1451560 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQN61_RS07765 (NCTC8320_01554) | - | 1451582..1451836 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| DQN61_RS07770 (NCTC8320_01555) | - | 1451817..1452173 (-) | 357 | WP_011018144.1 | HTH domain-containing protein | - |
| DQN61_RS09830 (NCTC8320_01556) | - | 1452184..1452321 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| DQN61_RS07775 (NCTC8320_01557) | - | 1452321..1453163 (-) | 843 | WP_011018146.1 | ATP-binding protein | - |
| DQN61_RS07780 (NCTC8320_01558) | - | 1453173..1454111 (-) | 939 | WP_011018147.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQN61_RS07785 (NCTC8320_01559) | - | 1454125..1454439 (-) | 315 | WP_021340228.1 | helix-turn-helix domain-containing protein | - |
| DQN61_RS10055 (NCTC8320_01560) | - | 1454455..1454589 (-) | 135 | WP_021340229.1 | hypothetical protein | - |
| DQN61_RS07790 (NCTC8320_01561) | - | 1454620..1454871 (-) | 252 | WP_021340237.1 | helix-turn-helix transcriptional regulator | - |
| DQN61_RS09835 | - | 1455110..1455277 (-) | 168 | WP_021340232.1 | hypothetical protein | - |
| DQN61_RS07800 (NCTC8320_01563) | - | 1455281..1456000 (-) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| DQN61_RS07805 (NCTC8320_01564) | - | 1456028..1456240 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| DQN61_RS07810 (NCTC8320_01565) | - | 1456437..1456778 (+) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| DQN61_RS07815 (NCTC8320_01566) | - | 1456762..1457148 (+) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQN61_RS07820 (NCTC8320_01567) | - | 1457163..1458584 (+) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| DQN61_RS07825 (NCTC8320_01568) | - | 1458762..1459928 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=1140001 DQN61_RS07525 WP_011018104.1 1418398..1418580(-) (prx) [Streptococcus pyogenes strain NCTC8320]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1140001 DQN61_RS07525 WP_011018104.1 1418398..1418580(-) (prx) [Streptococcus pyogenes strain NCTC8320]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |