Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM81_RS03520 | Genome accession | NZ_LS483389 |
| Coordinates | 664716..664898 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain NCTC10879 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 628207..664898 | 664716..664898 | within | 0 |
Gene organization within MGE regions
Location: 628207..664898
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM81_RS03245 (NCTC10879_00639) | - | 628225..629067 (+) | 843 | WP_063631457.1 | SGNH/GDSL hydrolase family protein | - |
| DQM81_RS03250 (NCTC10879_00640) | - | 629045..629632 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQM81_RS03255 (NCTC10879_00641) | - | 629731..630006 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQM81_RS03260 (NCTC10879_00642) | - | 630095..631237 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM81_RS03265 (NCTC10879_00643) | - | 631361..631879 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| DQM81_RS03270 (NCTC10879_00644) | - | 631891..632646 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQM81_RS03275 (NCTC10879_00645) | - | 632848..633060 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQM81_RS03280 (NCTC10879_00647) | - | 633330..633641 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQM81_RS03285 (NCTC10879_00648) | - | 633643..633828 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQM81_RS09985 | - | 633922..634191 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQM81_RS03295 (NCTC10879_00649) | - | 634332..634718 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQM81_RS03300 (NCTC10879_00650) | - | 634699..634932 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQM81_RS03305 (NCTC10879_00651) | - | 634929..635069 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQM81_RS03310 (NCTC10879_00652) | - | 635078..635284 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQM81_RS03315 (NCTC10879_00653) | - | 635340..635669 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| DQM81_RS03320 (NCTC10879_00654) | - | 635672..636598 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQM81_RS03325 (NCTC10879_00655) | - | 636595..636795 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQM81_RS03330 (NCTC10879_00656) | - | 636788..637585 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQM81_RS03335 (NCTC10879_00658) | - | 637950..638345 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQM81_RS09990 (NCTC10879_00659) | - | 638342..638776 (+) | 435 | WP_231872666.1 | hypothetical protein | - |
| DQM81_RS09995 (NCTC10879_00660) | - | 638855..639688 (+) | 834 | WP_231872667.1 | PcfJ domain-containing protein | - |
| DQM81_RS03345 (NCTC10879_00661) | - | 639699..640031 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQM81_RS03350 (NCTC10879_00662) | - | 640028..640540 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQM81_RS03355 (NCTC10879_00663) | - | 640576..640893 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQM81_RS09835 (NCTC10879_00664) | - | 640890..641045 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQM81_RS03360 (NCTC10879_00665) | - | 641042..641293 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQM81_RS03365 (NCTC10879_00666) | - | 641369..641788 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DQM81_RS03370 | - | 641896..642240 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQM81_RS03375 (NCTC10879_00667) | - | 642388..642744 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQM81_RS03380 (NCTC10879_00668) | - | 642741..644009 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQM81_RS03385 (NCTC10879_00669) | - | 644002..645495 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQM81_RS03390 (NCTC10879_00670) | - | 645501..645725 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQM81_RS03395 (NCTC10879_00671) | - | 645777..646043 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQM81_RS03400 | - | 646045..646281 (+) | 237 | Protein_595 | hypothetical protein | - |
| DQM81_RS03405 (NCTC10879_00672) | - | 646363..647778 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| DQM81_RS03410 (NCTC10879_00673) | - | 647858..648319 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQM81_RS03415 (NCTC10879_00674) | - | 648344..649255 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| DQM81_RS03420 (NCTC10879_00675) | - | 649255..649455 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQM81_RS03425 (NCTC10879_00676) | - | 649465..649887 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQM81_RS03430 (NCTC10879_00677) | - | 649847..650185 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQM81_RS03435 (NCTC10879_00678) | - | 650178..650414 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQM81_RS03440 (NCTC10879_00679) | - | 650415..650750 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| DQM81_RS03445 (NCTC10879_00680) | - | 650762..651340 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| DQM81_RS03450 (NCTC10879_00681) | - | 651351..651614 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| DQM81_RS03455 (NCTC10879_00682) | - | 651629..652000 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| DQM81_RS03460 (NCTC10879_00683) | - | 652000..654357 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| DQM81_RS03465 (NCTC10879_00684) | - | 654354..655049 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQM81_RS03470 (NCTC10879_00685) | - | 655031..657007 (+) | 1977 | WP_028797149.1 | phage tail spike protein | - |
| DQM81_RS03475 (NCTC10879_00686) | hylP | 657004..658119 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| DQM81_RS03480 (NCTC10879_00687) | - | 658134..659915 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| DQM81_RS03485 (NCTC10879_00688) | - | 659924..660352 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DQM81_RS03490 (NCTC10879_00689) | - | 660355..660987 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| DQM81_RS03495 (NCTC10879_00690) | - | 660999..661271 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM81_RS03500 (NCTC10879_00691) | - | 661268..661495 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQM81_RS03505 (NCTC10879_00693) | - | 661614..662831 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| DQM81_RS03510 (NCTC10879_00694) | speC | 662900..663607 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQM81_RS03515 (NCTC10879_00695) | mf2 | 663718..664476 (-) | 759 | WP_014635573.1 | DNase Mf2 | - |
| DQM81_RS03520 (NCTC10879_00696) | prx | 664716..664898 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=1139852 DQM81_RS03520 WP_014635572.1 664716..664898(+) (prx) [Streptococcus pyogenes strain NCTC10879]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1139852 DQM81_RS03520 WP_014635572.1 664716..664898(+) (prx) [Streptococcus pyogenes strain NCTC10879]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |