Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM82_RS03250 | Genome accession | NZ_LS483386 |
| Coordinates | 594331..594510 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC13742 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 549075..594572 | 594331..594510 | within | 0 |
Gene organization within MGE regions
Location: 549075..594572
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM82_RS02930 (NCTC13742_00575) | - | 549075..549524 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| DQM82_RS02935 (NCTC13742_00576) | - | 549699..549983 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| DQM82_RS02940 (NCTC13742_00577) | - | 549976..551238 (+) | 1263 | WP_050336105.1 | chloride channel protein | - |
| DQM82_RS02945 (NCTC13742_00578) | rplS | 551353..551700 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| DQM82_RS02955 (NCTC13742_00580) | - | 552063..553139 (-) | 1077 | WP_023612372.1 | tyrosine-type recombinase/integrase | - |
| DQM82_RS02960 (NCTC13742_00581) | - | 553258..553779 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| DQM82_RS02965 (NCTC13742_00582) | - | 553790..554167 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM82_RS02970 (NCTC13742_00583) | - | 554151..554510 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| DQM82_RS02975 (NCTC13742_00584) | - | 554698..554916 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| DQM82_RS02980 (NCTC13742_00585) | - | 555016..555246 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| DQM82_RS02985 (NCTC13742_00587) | - | 555383..555601 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| DQM82_RS02990 (NCTC13742_00588) | - | 555603..555845 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| DQM82_RS02995 (NCTC13742_00589) | - | 555829..557148 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| DQM82_RS03000 (NCTC13742_00590) | - | 557163..558245 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| DQM82_RS10145 (NCTC13742_00591) | - | 558284..558418 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| DQM82_RS03005 (NCTC13742_00592) | - | 558440..559033 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| DQM82_RS03010 (NCTC13742_00593) | - | 559033..560616 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| DQM82_RS03015 (NCTC13742_00594) | - | 560629..560823 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| DQM82_RS03020 | - | 560846..563088 (+) | 2243 | Protein_535 | AAA family ATPase | - |
| DQM82_RS03025 (NCTC13742_00597) | - | 563380..563562 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| DQM82_RS03030 (NCTC13742_00598) | - | 563555..563950 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQM82_RS03035 (NCTC13742_00599) | - | 563947..564171 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| DQM82_RS03040 (NCTC13742_00600) | - | 564174..564359 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| DQM82_RS03045 (NCTC13742_00601) | - | 564356..564607 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| DQM82_RS03050 (NCTC13742_00602) | - | 564591..564995 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| DQM82_RS03055 (NCTC13742_00603) | - | 564992..565276 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQM82_RS03060 (NCTC13742_00604) | - | 565278..565910 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQM82_RS03065 (NCTC13742_00605) | - | 565913..566623 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQM82_RS03070 (NCTC13742_00606) | - | 566620..566991 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQM82_RS03075 (NCTC13742_00607) | - | 567259..567696 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| DQM82_RS03090 | - | 568215..568460 (-) | 246 | WP_153279561.1 | hypothetical protein | - |
| DQM82_RS03095 (NCTC13742_00608) | - | 568553..569071 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| DQM82_RS03100 (NCTC13742_00609) | - | 569050..569727 (+) | 678 | WP_111711133.1 | ABC transporter ATP-binding protein | - |
| DQM82_RS09970 | - | 569736..570119 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| DQM82_RS03110 (NCTC13742_00610) | - | 570180..570557 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DQM82_RS03115 (NCTC13742_00611) | - | 570599..571081 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| DQM82_RS03120 (NCTC13742_00612) | - | 571164..572375 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DQM82_RS03125 (NCTC13742_00613) | - | 572389..573891 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| DQM82_RS03130 (NCTC13742_00614) | - | 573896..575374 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DQM82_RS03135 (NCTC13742_00615) | - | 575346..575585 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQM82_RS03140 (NCTC13742_00616) | - | 575647..575913 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQM82_RS03145 (NCTC13742_00617) | - | 576039..576653 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| DQM82_RS03150 (NCTC13742_00618) | - | 576657..577475 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQM82_RS03155 (NCTC13742_00619) | - | 577529..577945 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| DQM82_RS03160 (NCTC13742_00620) | - | 577935..578267 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQM82_RS03165 (NCTC13742_00621) | - | 578267..578623 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQM82_RS03170 (NCTC13742_00622) | - | 578620..579018 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQM82_RS03175 (NCTC13742_00623) | - | 579018..579503 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQM82_RS03180 (NCTC13742_00624) | - | 579542..579976 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| DQM82_RS03185 (NCTC13742_00625) | - | 579980..580561 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| DQM82_RS03190 (NCTC13742_00626) | - | 580551..583811 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| DQM82_RS03195 (NCTC13742_00627) | - | 583808..584524 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| DQM82_RS03200 (NCTC13742_00628) | - | 584521..586668 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| DQM82_RS03205 (NCTC13742_00629) | - | 586665..587879 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DQM82_RS03210 (NCTC13742_00630) | - | 587881..588195 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DQM82_RS03215 (NCTC13742_00631) | - | 588206..590095 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| DQM82_RS03220 (NCTC13742_00632) | - | 590107..590535 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQM82_RS03225 (NCTC13742_00633) | - | 590538..591170 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| DQM82_RS03230 (NCTC13742_00634) | - | 591182..591454 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM82_RS03235 (NCTC13742_00635) | - | 591451..591678 (+) | 228 | WP_011054444.1 | phage holin | - |
| DQM82_RS03240 (NCTC13742_00637) | - | 591794..593002 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| DQM82_RS03245 (NCTC13742_00638) | - | 593112..594098 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| DQM82_RS03250 (NCTC13742_00639) | prx | 594331..594510 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=1139696 DQM82_RS03250 WP_030127450.1 594331..594510(+) (prx) [Streptococcus pyogenes strain NCTC13742]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=1139696 DQM82_RS03250 WP_030127450.1 594331..594510(+) (prx) [Streptococcus pyogenes strain NCTC13742]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |