Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM89_RS07160 | Genome accession | NZ_LS483382 |
| Coordinates | 1379186..1379365 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain NCTC13738 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1379186..1419803 | 1379186..1379365 | within | 0 |
Gene organization within MGE regions
Location: 1379186..1419803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM89_RS07160 (NCTC13738_01426) | prx | 1379186..1379365 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| DQM89_RS07165 (NCTC13738_01427) | sda1 | 1379604..1380776 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| DQM89_RS07170 (NCTC13738_01428) | - | 1380892..1382088 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| DQM89_RS07175 (NCTC13738_01430) | - | 1382199..1382384 (-) | 186 | WP_021341107.1 | holin | - |
| DQM89_RS07180 (NCTC13738_01431) | - | 1382381..1382680 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| DQM89_RS07185 (NCTC13738_01432) | - | 1382691..1383311 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| DQM89_RS07190 (NCTC13738_01433) | - | 1383314..1383475 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| DQM89_RS07195 (NCTC13738_01434) | - | 1383484..1385391 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| DQM89_RS07200 (NCTC13738_01435) | - | 1385402..1386037 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| DQM89_RS07205 (NCTC13738_01436) | - | 1386037..1387092 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| DQM89_RS07210 (NCTC13738_01437) | - | 1387089..1389071 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| DQM89_RS07215 (NCTC13738_01438) | - | 1389081..1389923 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| DQM89_RS07220 (NCTC13738_01439) | - | 1389935..1394317 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| DQM89_RS07225 (NCTC13738_01440) | - | 1394332..1394565 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| DQM89_RS07230 (NCTC13738_01441) | - | 1394640..1395095 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DQM89_RS07235 (NCTC13738_01442) | - | 1395149..1395748 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| DQM89_RS07240 (NCTC13738_01443) | - | 1395760..1396119 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| DQM89_RS07245 (NCTC13738_01444) | - | 1396123..1396467 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM89_RS07250 (NCTC13738_01445) | - | 1396464..1396742 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| DQM89_RS07255 (NCTC13738_01446) | - | 1396753..1397109 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| DQM89_RS07260 (NCTC13738_01447) | - | 1397121..1398008 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| DQM89_RS07265 (NCTC13738_01448) | - | 1398021..1398590 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| DQM89_RS07270 (NCTC13738_01449) | - | 1398746..1399012 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| DQM89_RS07275 | - | 1399015..1399203 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| DQM89_RS07280 (NCTC13738_01451) | - | 1399234..1400679 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| DQM89_RS07285 (NCTC13738_01452) | - | 1400639..1402171 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| DQM89_RS07290 (NCTC13738_01453) | - | 1402187..1403464 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| DQM89_RS07295 (NCTC13738_01454) | - | 1403454..1403906 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| DQM89_RS07300 (NCTC13738_01455) | - | 1403996..1404412 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DQM89_RS07305 (NCTC13738_01456) | - | 1404409..1404600 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| DQM89_RS07310 (NCTC13738_01457) | - | 1404590..1405378 (-) | 789 | WP_229363273.1 | DNA-methyltransferase | - |
| DQM89_RS07315 (NCTC13738_01458) | - | 1405450..1405716 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| DQM89_RS09595 (NCTC13738_01459) | - | 1405713..1405880 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| DQM89_RS07320 (NCTC13738_01460) | - | 1405881..1407203 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| DQM89_RS07325 (NCTC13738_01461) | - | 1407200..1407475 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| DQM89_RS07330 (NCTC13738_01462) | - | 1407862..1410246 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| DQM89_RS07335 (NCTC13738_01463) | - | 1410251..1412173 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| DQM89_RS07340 (NCTC13738_01464) | - | 1412216..1412773 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| DQM89_RS07345 (NCTC13738_01465) | - | 1412784..1413182 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| DQM89_RS07350 (NCTC13738_01466) | - | 1413186..1414340 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| DQM89_RS07355 (NCTC13738_01467) | - | 1414340..1414639 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| DQM89_RS07360 (NCTC13738_01468) | - | 1414727..1414930 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| DQM89_RS07365 (NCTC13738_01470) | - | 1415077..1415463 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| DQM89_RS07370 (NCTC13738_01471) | - | 1415460..1415663 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| DQM89_RS07375 (NCTC13738_01472) | - | 1415656..1415826 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| DQM89_RS07380 (NCTC13738_01473) | - | 1415823..1416098 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| DQM89_RS07385 (NCTC13738_01474) | - | 1416160..1416375 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| DQM89_RS07390 (NCTC13738_01475) | - | 1416423..1416836 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| DQM89_RS09600 (NCTC13738_01476) | - | 1416817..1416972 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| DQM89_RS07395 (NCTC13738_01477) | - | 1417298..1417648 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| DQM89_RS07400 (NCTC13738_01478) | - | 1417662..1418045 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM89_RS07405 (NCTC13738_01479) | - | 1418056..1418607 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| DQM89_RS07410 (NCTC13738_01480) | - | 1418724..1419803 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=1139466 DQM89_RS07160 WP_002988813.1 1379186..1379365(-) (prx) [Streptococcus pyogenes strain NCTC13738]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1139466 DQM89_RS07160 WP_002988813.1 1379186..1379365(-) (prx) [Streptococcus pyogenes strain NCTC13738]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |