Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM89_RS03175 | Genome accession | NZ_LS483382 |
| Coordinates | 583856..584035 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC13738 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 537263..587391 | 583856..584035 | within | 0 |
Gene organization within MGE regions
Location: 537263..587391
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM89_RS02850 (NCTC13738_00561) | - | 537263..538204 (-) | 942 | WP_011528442.1 | DHH family phosphoesterase | - |
| DQM89_RS02855 (NCTC13738_00562) | - | 538598..539047 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| DQM89_RS02860 (NCTC13738_00563) | - | 539222..539506 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| DQM89_RS02865 (NCTC13738_00564) | - | 539499..540761 (+) | 1263 | WP_076634117.1 | voltage-gated chloride channel family protein | - |
| DQM89_RS02870 (NCTC13738_00565) | rplS | 540876..541223 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| DQM89_RS02880 (NCTC13738_00567) | - | 541587..542663 (-) | 1077 | WP_023612372.1 | tyrosine-type recombinase/integrase | - |
| DQM89_RS02885 (NCTC13738_00568) | - | 542782..543303 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| DQM89_RS02890 (NCTC13738_00569) | - | 543314..543691 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM89_RS02895 (NCTC13738_00570) | - | 543675..544034 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| DQM89_RS02900 (NCTC13738_00571) | - | 544222..544440 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| DQM89_RS02905 (NCTC13738_00572) | - | 544540..544770 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| DQM89_RS09545 (NCTC13738_00573) | - | 544754..544897 (+) | 144 | WP_164492191.1 | hypothetical protein | - |
| DQM89_RS02910 (NCTC13738_00574) | - | 544907..545125 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| DQM89_RS02915 (NCTC13738_00575) | - | 545127..545369 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| DQM89_RS02920 (NCTC13738_00576) | - | 545353..546672 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| DQM89_RS02925 (NCTC13738_00577) | - | 546687..547769 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| DQM89_RS09775 (NCTC13738_00578) | - | 547808..547942 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| DQM89_RS02930 (NCTC13738_00579) | - | 547964..548557 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| DQM89_RS02935 (NCTC13738_00580) | - | 548557..550140 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| DQM89_RS02940 (NCTC13738_00581) | - | 550153..550347 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| DQM89_RS02945 (NCTC13738_00582) | - | 550370..552613 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| DQM89_RS02950 (NCTC13738_00583) | - | 552905..553087 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| DQM89_RS02955 (NCTC13738_00584) | - | 553080..553475 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQM89_RS02960 (NCTC13738_00585) | - | 553472..553696 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| DQM89_RS02965 (NCTC13738_00586) | - | 553699..553884 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| DQM89_RS02970 (NCTC13738_00587) | - | 553881..554132 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| DQM89_RS02975 (NCTC13738_00588) | - | 554116..554520 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| DQM89_RS02980 (NCTC13738_00589) | - | 554517..554801 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQM89_RS02985 (NCTC13738_00590) | - | 554803..555435 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQM89_RS02990 (NCTC13738_00591) | - | 555438..556148 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQM89_RS02995 (NCTC13738_00592) | - | 556145..556516 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQM89_RS03000 (NCTC13738_00593) | - | 556784..557221 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| DQM89_RS03015 | - | 557740..557997 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| DQM89_RS03020 (NCTC13738_00594) | - | 558078..558596 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| DQM89_RS03025 (NCTC13738_00595) | - | 558575..559252 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| DQM89_RS09615 | - | 559261..559644 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| DQM89_RS03035 (NCTC13738_00596) | - | 559705..560082 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DQM89_RS03040 (NCTC13738_00597) | - | 560124..560606 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| DQM89_RS03045 (NCTC13738_00598) | - | 560689..561900 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DQM89_RS03050 (NCTC13738_00599) | - | 561914..563416 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| DQM89_RS03055 (NCTC13738_00600) | - | 563421..564899 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| DQM89_RS03060 (NCTC13738_00601) | - | 564871..565110 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQM89_RS03065 (NCTC13738_00602) | - | 565172..565438 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQM89_RS03070 (NCTC13738_00603) | - | 565564..566178 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| DQM89_RS03075 (NCTC13738_00604) | - | 566182..567000 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQM89_RS03080 (NCTC13738_00605) | - | 567054..567470 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| DQM89_RS03085 (NCTC13738_00606) | - | 567460..567792 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQM89_RS03090 (NCTC13738_00607) | - | 567792..568148 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQM89_RS03095 (NCTC13738_00608) | - | 568145..568543 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQM89_RS03100 (NCTC13738_00609) | - | 568543..569028 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQM89_RS03105 (NCTC13738_00610) | - | 569067..569501 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| DQM89_RS03110 (NCTC13738_00611) | - | 569505..570086 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| DQM89_RS03115 (NCTC13738_00612) | - | 570076..573336 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| DQM89_RS03120 (NCTC13738_00613) | - | 573333..574049 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| DQM89_RS03125 (NCTC13738_00614) | - | 574046..576193 (+) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| DQM89_RS03130 (NCTC13738_00615) | - | 576190..577404 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DQM89_RS03135 (NCTC13738_00616) | - | 577406..577720 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DQM89_RS03140 (NCTC13738_00617) | - | 577731..579620 (+) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| DQM89_RS03145 (NCTC13738_00618) | - | 579632..580060 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQM89_RS03150 (NCTC13738_00619) | - | 580063..580695 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| DQM89_RS03155 (NCTC13738_00620) | - | 580707..580979 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM89_RS03160 (NCTC13738_00621) | - | 580976..581203 (+) | 228 | WP_011054444.1 | phage holin | - |
| DQM89_RS03165 (NCTC13738_00623) | - | 581319..582527 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| DQM89_RS03170 (NCTC13738_00624) | - | 582637..583623 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| DQM89_RS03175 (NCTC13738_00625) | prx | 583856..584035 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
| DQM89_RS09875 | - | 584216..584500 (-) | 285 | Protein_567 | site-specific integrase | - |
| DQM89_RS09670 | - | 584505..584775 (+) | 271 | Protein_568 | rod shape-determining protein RodA | - |
| DQM89_RS03185 (NCTC13738_00627) | - | 584878..585438 (+) | 561 | WP_076634127.1 | HAD-IA family hydrolase | - |
| DQM89_RS03190 (NCTC13738_00628) | gyrB | 585439..587391 (+) | 1953 | WP_002994058.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=1139452 DQM89_RS03175 WP_030127450.1 583856..584035(+) (prx) [Streptococcus pyogenes strain NCTC13738]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=1139452 DQM89_RS03175 WP_030127450.1 583856..584035(+) (prx) [Streptococcus pyogenes strain NCTC13738]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |