Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM61_RS05040 | Genome accession | NZ_LS483379 |
| Coordinates | 975651..975839 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain NCTC10874 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 965723..1021681 | 975651..975839 | within | 0 |
Gene organization within MGE regions
Location: 965723..1021681
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM61_RS04995 (NCTC10874_00988) | lepB | 965723..966280 (-) | 558 | WP_002984449.1 | signal peptidase I | - |
| DQM61_RS05000 (NCTC10874_00989) | pyk | 966498..968000 (-) | 1503 | WP_111694366.1 | pyruvate kinase | - |
| DQM61_RS05005 (NCTC10874_00990) | pfkA | 968063..969076 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| DQM61_RS05010 (NCTC10874_00991) | - | 969156..972266 (-) | 3111 | WP_023609809.1 | DNA polymerase III subunit alpha | - |
| DQM61_RS05015 (NCTC10874_00992) | - | 972451..972822 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DQM61_RS05020 (NCTC10874_00993) | - | 972822..973520 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQM61_RS05025 (NCTC10874_00994) | - | 973530..974315 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| DQM61_RS05030 (NCTC10874_00995) | - | 974446..975060 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM61_RS05040 (NCTC10874_00997) | prx | 975651..975839 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| DQM61_RS05045 (NCTC10874_00998) | entC3 | 975952..976734 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| DQM61_RS05050 (NCTC10874_00999) | - | 976947..978071 (-) | 1125 | WP_023609814.1 | Fic family protein | - |
| DQM61_RS05055 (NCTC10874_01000) | - | 978209..979417 (-) | 1209 | WP_023609806.1 | glucosaminidase domain-containing protein | - |
| DQM61_RS05060 (NCTC10874_01001) | - | 979533..979760 (-) | 228 | WP_000609113.1 | phage holin | - |
| DQM61_RS05065 (NCTC10874_01002) | - | 979757..980032 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQM61_RS05070 (NCTC10874_01003) | - | 980042..980659 (-) | 618 | WP_023609813.1 | DUF1366 domain-containing protein | - |
| DQM61_RS05075 (NCTC10874_01004) | - | 980662..981093 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| DQM61_RS05080 (NCTC10874_01005) | - | 981105..983123 (-) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| DQM61_RS05085 (NCTC10874_01006) | - | 983133..984242 (-) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| DQM61_RS05090 (NCTC10874_01007) | - | 984242..986389 (-) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| DQM61_RS05095 (NCTC10874_01008) | - | 986386..987093 (-) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| DQM61_RS05100 (NCTC10874_01009) | - | 987093..991016 (-) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| DQM61_RS08995 | - | 991029..991178 (-) | 150 | WP_023609816.1 | hypothetical protein | - |
| DQM61_RS05105 (NCTC10874_01010) | gpG | 991226..991552 (-) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| DQM61_RS05110 (NCTC10874_01011) | - | 991605..992216 (-) | 612 | WP_011054557.1 | major tail protein | - |
| DQM61_RS05115 (NCTC10874_01012) | - | 992235..992660 (-) | 426 | WP_011054558.1 | hypothetical protein | - |
| DQM61_RS05120 (NCTC10874_01013) | - | 992657..993034 (-) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM61_RS05125 (NCTC10874_01014) | - | 993031..993369 (-) | 339 | WP_011054560.1 | phage head closure protein | - |
| DQM61_RS05130 (NCTC10874_01015) | - | 993366..993668 (-) | 303 | WP_011054561.1 | head-tail connector protein | - |
| DQM61_RS09250 | - | 993671..993799 (-) | 129 | WP_011054562.1 | hypothetical protein | - |
| DQM61_RS05135 (NCTC10874_01016) | - | 993813..994997 (-) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| DQM61_RS05140 (NCTC10874_01017) | - | 995023..995688 (-) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| DQM61_RS05145 (NCTC10874_01018) | - | 995666..996886 (-) | 1221 | WP_011054565.1 | phage portal protein | - |
| DQM61_RS05150 (NCTC10874_01019) | - | 996920..997186 (-) | 267 | WP_011054566.1 | hypothetical protein | - |
| DQM61_RS09000 (NCTC10874_01020) | - | 997179..997349 (-) | 171 | WP_011054567.1 | hypothetical protein | - |
| DQM61_RS05155 (NCTC10874_01021) | - | 997346..999100 (-) | 1755 | WP_011054568.1 | terminase large subunit | - |
| DQM61_RS05160 (NCTC10874_01022) | - | 999115..999582 (-) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| DQM61_RS05165 (NCTC10874_01023) | - | 999753..1000091 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQM61_RS05175 (NCTC10874_01024) | - | 1000677..1001117 (-) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM61_RS05185 (NCTC10874_01025) | - | 1001390..1002025 (-) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| DQM61_RS05190 (NCTC10874_01026) | - | 1002025..1002426 (-) | 402 | WP_011054573.1 | hypothetical protein | - |
| DQM61_RS05195 (NCTC10874_01027) | - | 1002617..1002991 (-) | 375 | WP_023609812.1 | methyltransferase domain-containing protein | - |
| DQM61_RS05200 (NCTC10874_01028) | - | 1003016..1003300 (-) | 285 | WP_011106747.1 | hypothetical protein | - |
| DQM61_RS05205 (NCTC10874_01029) | - | 1003297..1003500 (-) | 204 | WP_011054575.1 | hypothetical protein | - |
| DQM61_RS05210 (NCTC10874_01030) | - | 1003484..1003804 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DQM61_RS05215 (NCTC10874_01031) | - | 1003801..1004214 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQM61_RS05220 (NCTC10874_01032) | - | 1004476..1005951 (-) | 1476 | WP_021733182.1 | phage/plasmid primase, P4 family | - |
| DQM61_RS05225 (NCTC10874_01033) | - | 1005941..1006753 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQM61_RS05230 (NCTC10874_01034) | - | 1006756..1007214 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQM61_RS05235 (NCTC10874_01035) | - | 1007230..1008459 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQM61_RS05240 (NCTC10874_01036) | - | 1008561..1009241 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQM61_RS05245 (NCTC10874_01037) | - | 1009242..1009724 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQM61_RS05250 (NCTC10874_01038) | - | 1009953..1010267 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| DQM61_RS05255 (NCTC10874_01039) | - | 1010414..1010710 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| DQM61_RS05260 (NCTC10874_01040) | - | 1010788..1010973 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM61_RS05265 (NCTC10874_01041) | - | 1011140..1011379 (+) | 240 | WP_011054586.1 | hypothetical protein | - |
| DQM61_RS05270 (NCTC10874_01042) | - | 1011530..1011739 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQM61_RS05280 (NCTC10874_01044) | - | 1011955..1012194 (-) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| DQM61_RS05285 (NCTC10874_01045) | - | 1012268..1012654 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| DQM61_RS05290 (NCTC10874_01046) | - | 1012643..1012849 (-) | 207 | WP_011054590.1 | hypothetical protein | - |
| DQM61_RS05295 (NCTC10874_01047) | - | 1012906..1013685 (+) | 780 | WP_011054591.1 | hypothetical protein | - |
| DQM61_RS05300 (NCTC10874_01049) | - | 1013819..1013965 (-) | 147 | WP_011054593.1 | hypothetical protein | - |
| DQM61_RS05305 (NCTC10874_01051) | - | 1014338..1015126 (+) | 789 | WP_021340822.1 | S24 family peptidase | - |
| DQM61_RS05310 (NCTC10874_01052) | - | 1015136..1015441 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DQM61_RS05315 (NCTC10874_01053) | - | 1015561..1016649 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DQM61_RS05320 (NCTC10874_01054) | - | 1017012..1017632 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQM61_RS05325 (NCTC10874_01055) | glgP | 1017889..1020153 (-) | 2265 | WP_111694367.1 | glycogen/starch/alpha-glucan family phosphorylase | - |
| DQM61_RS05330 (NCTC10874_01056) | malQ | 1020188..1021681 (-) | 1494 | WP_002992582.1 | 4-alpha-glucanotransferase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1139288 DQM61_RS05040 WP_011054546.1 975651..975839(-) (prx) [Streptococcus pyogenes strain NCTC10874]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1139288 DQM61_RS05040 WP_011054546.1 975651..975839(-) (prx) [Streptococcus pyogenes strain NCTC10874]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |