Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM53_RS10180 | Genome accession | NZ_LS483361 |
| Coordinates | 2058848..2059030 (-) | Length | 60 a.a. |
| NCBI ID | WP_111717696.1 | Uniprot ID | A0A9X8T223 |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC6179 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2052620..2104203 | 2058848..2059030 | within | 0 |
Gene organization within MGE regions
Location: 2052620..2104203
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM53_RS10145 (NCTC6179_02078) | - | 2053125..2053403 (+) | 279 | WP_111717690.1 | GNAT family N-acetyltransferase | - |
| DQM53_RS10150 (NCTC6179_02079) | - | 2053705..2054289 (+) | 585 | WP_111717691.1 | GNAT family N-acetyltransferase | - |
| DQM53_RS10155 (NCTC6179_02080) | - | 2054277..2054537 (+) | 261 | WP_111717692.1 | hypothetical protein | - |
| DQM53_RS10160 (NCTC6179_02081) | - | 2054549..2056606 (+) | 2058 | WP_111717693.1 | sodium:proton antiporter | - |
| DQM53_RS10165 (NCTC6179_02082) | - | 2056739..2057200 (+) | 462 | WP_231871986.1 | VOC family protein | - |
| DQM53_RS10170 (NCTC6179_02083) | - | 2057376..2057984 (+) | 609 | WP_111717694.1 | flavin reductase family protein | - |
| DQM53_RS10175 (NCTC6179_02084) | - | 2057997..2058617 (+) | 621 | WP_111717695.1 | alpha/beta hydrolase | - |
| DQM53_RS10180 (NCTC6179_02085) | prx | 2058848..2059030 (-) | 183 | WP_111717696.1 | Paratox | Regulator |
| DQM53_RS10185 (NCTC6179_02086) | - | 2059200..2059508 (+) | 309 | WP_111717697.1 | hypothetical protein | - |
| DQM53_RS10190 (NCTC6179_02087) | - | 2059540..2060013 (+) | 474 | WP_111717698.1 | hypothetical protein | - |
| DQM53_RS10195 (NCTC6179_02088) | - | 2060015..2060200 (+) | 186 | WP_111717699.1 | XRE family transcriptional regulator | - |
| DQM53_RS10200 (NCTC6179_02089) | - | 2060298..2060498 (-) | 201 | WP_011888781.1 | CsbD family protein | - |
| DQM53_RS10205 (NCTC6179_02091) | - | 2060752..2061885 (-) | 1134 | WP_111714946.1 | ISAs1 family transposase | - |
| DQM53_RS10210 (NCTC6179_02092) | - | 2062008..2062979 (-) | 972 | WP_011888780.1 | Abi family protein | - |
| DQM53_RS10215 (NCTC6179_02093) | - | 2063285..2064502 (-) | 1218 | WP_111717700.1 | peptidoglycan amidohydrolase family protein | - |
| DQM53_RS10220 (NCTC6179_02095) | - | 2064616..2064801 (-) | 186 | WP_011888776.1 | holin | - |
| DQM53_RS10225 (NCTC6179_02096) | - | 2064798..2065097 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| DQM53_RS10230 (NCTC6179_02097) | - | 2065108..2065728 (-) | 621 | WP_111717701.1 | DUF1366 domain-containing protein | - |
| DQM53_RS10235 (NCTC6179_02098) | - | 2065731..2066159 (-) | 429 | WP_111717702.1 | DUF1617 family protein | - |
| DQM53_RS10240 (NCTC6179_02099) | - | 2066171..2068057 (-) | 1887 | WP_111717703.1 | gp58-like family protein | - |
| DQM53_RS10245 (NCTC6179_02100) | - | 2068068..2068691 (-) | 624 | WP_111717704.1 | hypothetical protein | - |
| DQM53_RS10250 (NCTC6179_02101) | - | 2068694..2070091 (-) | 1398 | WP_111717705.1 | hypothetical protein | - |
| DQM53_RS10255 (NCTC6179_02102) | - | 2070088..2072235 (-) | 2148 | WP_111717706.1 | phage tail spike protein | - |
| DQM53_RS10260 (NCTC6179_02103) | - | 2072232..2072948 (-) | 717 | WP_111717707.1 | distal tail protein Dit | - |
| DQM53_RS10265 (NCTC6179_02104) | - | 2072945..2076205 (-) | 3261 | WP_111717708.1 | tape measure protein | - |
| DQM53_RS10270 (NCTC6179_02105) | - | 2076195..2076776 (-) | 582 | WP_111717709.1 | bacteriophage Gp15 family protein | - |
| DQM53_RS10275 (NCTC6179_02106) | - | 2076780..2077214 (-) | 435 | WP_111717710.1 | hypothetical protein | - |
| DQM53_RS10280 (NCTC6179_02107) | - | 2077257..2077745 (-) | 489 | WP_111717711.1 | phage tail protein | - |
| DQM53_RS10285 (NCTC6179_02108) | - | 2077745..2078143 (-) | 399 | WP_111717712.1 | minor capsid protein | - |
| DQM53_RS10290 (NCTC6179_02109) | - | 2078140..2078496 (-) | 357 | WP_111717713.1 | minor capsid protein | - |
| DQM53_RS10295 (NCTC6179_02110) | - | 2078496..2078828 (-) | 333 | WP_111717714.1 | minor capsid protein | - |
| DQM53_RS10300 (NCTC6179_02111) | - | 2078818..2079219 (-) | 402 | WP_164714920.1 | hypothetical protein | - |
| DQM53_RS10305 (NCTC6179_02112) | - | 2079245..2079514 (-) | 270 | WP_111717716.1 | HeH/LEM domain-containing protein | - |
| DQM53_RS10310 (NCTC6179_02113) | - | 2079524..2080360 (-) | 837 | WP_111717717.1 | N4-gp56 family major capsid protein | - |
| DQM53_RS10315 (NCTC6179_02114) | - | 2080364..2080978 (-) | 615 | WP_111717718.1 | hypothetical protein | - |
| DQM53_RS10320 (NCTC6179_02115) | - | 2081108..2081374 (-) | 267 | WP_111717719.1 | hypothetical protein | - |
| DQM53_RS10325 (NCTC6179_02116) | - | 2081412..2082356 (-) | 945 | WP_111715146.1 | IS30 family transposase | - |
| DQM53_RS10330 (NCTC6179_02117) | - | 2082512..2082739 (-) | 228 | WP_111717720.1 | hypothetical protein | - |
| DQM53_RS10335 (NCTC6179_02118) | - | 2082739..2084232 (-) | 1494 | WP_111717721.1 | phage minor capsid protein | - |
| DQM53_RS10340 (NCTC6179_02119) | - | 2084237..2085739 (-) | 1503 | WP_111717722.1 | phage portal protein | - |
| DQM53_RS10345 (NCTC6179_02120) | - | 2085753..2087048 (-) | 1296 | WP_164714885.1 | PBSX family phage terminase large subunit | - |
| DQM53_RS10350 (NCTC6179_02121) | terS | 2087041..2087736 (-) | 696 | WP_050318691.1 | phage terminase small subunit | - |
| DQM53_RS10355 (NCTC6179_02122) | - | 2087856..2088272 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DQM53_RS10360 (NCTC6179_02123) | - | 2088269..2088460 (-) | 192 | WP_111717723.1 | hypothetical protein | - |
| DQM53_RS10365 (NCTC6179_02124) | - | 2088464..2088730 (-) | 267 | WP_111717724.1 | hypothetical protein | - |
| DQM53_RS11260 (NCTC6179_02125) | - | 2088727..2088894 (-) | 168 | WP_164714884.1 | hypothetical protein | - |
| DQM53_RS10370 (NCTC6179_02126) | - | 2088895..2090217 (-) | 1323 | WP_002983414.1 | SNF2-related protein | - |
| DQM53_RS10375 (NCTC6179_02127) | - | 2090214..2090489 (-) | 276 | WP_111717725.1 | VRR-NUC domain-containing protein | - |
| DQM53_RS10380 (NCTC6179_02128) | - | 2090856..2093240 (-) | 2385 | WP_111717726.1 | phage/plasmid primase, P4 family | - |
| DQM53_RS10385 (NCTC6179_02129) | - | 2093245..2095167 (-) | 1923 | WP_111717727.1 | DNA polymerase | - |
| DQM53_RS10390 (NCTC6179_02130) | - | 2095210..2095773 (-) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| DQM53_RS10395 (NCTC6179_02131) | - | 2095787..2096944 (-) | 1158 | WP_002983409.1 | DUF2800 domain-containing protein | - |
| DQM53_RS10400 (NCTC6179_02132) | - | 2096944..2097243 (-) | 300 | WP_043024982.1 | hypothetical protein | - |
| DQM53_RS10405 (NCTC6179_02133) | - | 2097331..2097534 (-) | 204 | WP_002983407.1 | hypothetical protein | - |
| DQM53_RS10410 (NCTC6179_02135) | - | 2097680..2098063 (-) | 384 | WP_111717728.1 | hypothetical protein | - |
| DQM53_RS10415 (NCTC6179_02136) | - | 2098060..2098266 (-) | 207 | WP_050317062.1 | hypothetical protein | - |
| DQM53_RS10420 (NCTC6179_02137) | - | 2098259..2098429 (-) | 171 | WP_111717729.1 | hypothetical protein | - |
| DQM53_RS10425 (NCTC6179_02138) | - | 2098426..2098701 (-) | 276 | WP_003052448.1 | hypothetical protein | - |
| DQM53_RS10430 (NCTC6179_02139) | - | 2098762..2099562 (-) | 801 | WP_111717730.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM53_RS10435 (NCTC6179_02140) | - | 2099573..2099764 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| DQM53_RS10440 (NCTC6179_02141) | - | 2100522..2100869 (+) | 348 | WP_111717731.1 | helix-turn-helix transcriptional regulator | - |
| DQM53_RS10445 (NCTC6179_02142) | - | 2100873..2101259 (+) | 387 | WP_111705753.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM53_RS10450 (NCTC6179_02143) | - | 2101277..2102869 (+) | 1593 | WP_111717732.1 | SIR2 family protein | - |
| DQM53_RS10455 (NCTC6179_02144) | - | 2103130..2104203 (+) | 1074 | WP_111717733.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6918.75 Da Isoelectric Point: 3.9944
>NTDB_id=1138548 DQM53_RS10180 WP_111717696.1 2058848..2059030(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC6179]
MLTYDEFKQAIDDGYIAGDTVTIVRKNGQIFDYVLPGEPVRQWEVVTEEVVGEVTRELER
MLTYDEFKQAIDDGYIAGDTVTIVRKNGQIFDYVLPGEPVRQWEVVTEEVVGEVTRELER
Nucleotide
Download Length: 183 bp
>NTDB_id=1138548 DQM53_RS10180 WP_111717696.1 2058848..2059030(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis strain NCTC6179]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGATGACGGATATATCGCAGGAGACACAGTCACGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGCCTGTGAGACAGTGGGAAGTAGTGACGGAGGAAGTGGTGGGAGAAG
TGACGAGAGAGTTAGAACGCTAG
ATGCTAACATACGACGAATTTAAGCAAGCGATTGATGACGGATATATCGCAGGAGACACAGTCACGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGCCTGTGAGACAGTGGGAAGTAGTGACGGAGGAAGTGGTGGGAGAAG
TGACGAGAGAGTTAGAACGCTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
68.333 |
0.533 |