Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM47_RS04110 | Genome accession | NZ_LS483360 |
| Coordinates | 801343..801531 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC10876 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 760980..809119 | 801343..801531 | within | 0 |
Gene organization within MGE regions
Location: 760980..809119
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM47_RS03830 (NCTC10876_00758) | - | 760980..761600 (-) | 621 | WP_023610967.1 | DUF3862 domain-containing protein | - |
| DQM47_RS03835 (NCTC10876_00759) | - | 761963..763051 (-) | 1089 | WP_085577338.1 | site-specific integrase | - |
| DQM47_RS03840 (NCTC10876_00760) | - | 763171..763476 (-) | 306 | WP_011106738.1 | membrane protein | - |
| DQM47_RS03845 (NCTC10876_00761) | - | 763486..764274 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| DQM47_RS03850 (NCTC10876_00763) | - | 764647..764805 (+) | 159 | WP_080465047.1 | hypothetical protein | - |
| DQM47_RS03855 (NCTC10876_00765) | - | 764939..765724 (-) | 786 | WP_085577339.1 | hypothetical protein | - |
| DQM47_RS09860 (NCTC10876_00766) | - | 765781..765927 (+) | 147 | WP_021340823.1 | hypothetical protein | - |
| DQM47_RS03860 (NCTC10876_00767) | - | 765924..766406 (-) | 483 | WP_023605145.1 | hypothetical protein | - |
| DQM47_RS03865 (NCTC10876_00768) | - | 766480..766719 (+) | 240 | WP_021340169.1 | helix-turn-helix domain-containing protein | - |
| DQM47_RS03870 (NCTC10876_00769) | - | 766731..766976 (+) | 246 | WP_002984287.1 | hypothetical protein | - |
| DQM47_RS03880 (NCTC10876_00770) | - | 767200..767550 (+) | 351 | WP_111681188.1 | hypothetical protein | - |
| DQM47_RS03885 (NCTC10876_00771) | - | 767525..767839 (-) | 315 | WP_032461901.1 | hypothetical protein | - |
| DQM47_RS03890 | - | 767982..768167 (+) | 186 | WP_032461902.1 | helix-turn-helix domain-containing protein | - |
| DQM47_RS03895 (NCTC10876_00772) | - | 768246..768542 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQM47_RS03900 (NCTC10876_00773) | - | 768539..768676 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DQM47_RS03905 (NCTC10876_00775) | - | 768757..769086 (+) | 330 | WP_085577340.1 | hypothetical protein | - |
| DQM47_RS03910 (NCTC10876_00776) | - | 769086..769280 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQM47_RS03915 (NCTC10876_00777) | - | 769277..769561 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DQM47_RS03920 (NCTC10876_00778) | - | 769558..770241 (+) | 684 | WP_014635524.1 | AAA family ATPase | - |
| DQM47_RS03925 (NCTC10876_00779) | - | 770247..771680 (+) | 1434 | Protein_699 | DEAD/DEAH box helicase | - |
| DQM47_RS03930 (NCTC10876_00780) | - | 771685..772167 (+) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| DQM47_RS03935 (NCTC10876_00781) | - | 772185..773738 (+) | 1554 | WP_011017876.1 | hypothetical protein | - |
| DQM47_RS03940 (NCTC10876_00782) | - | 774007..774876 (+) | 870 | WP_085577343.1 | bifunctional DNA primase/polymerase | - |
| DQM47_RS03945 (NCTC10876_00783) | - | 774896..775180 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DQM47_RS03950 (NCTC10876_00784) | - | 775164..775520 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQM47_RS10155 | - | 775517..775766 (+) | 250 | Protein_705 | hypothetical protein | - |
| DQM47_RS03960 | - | 775760..776044 (+) | 285 | Protein_706 | DUF3310 domain-containing protein | - |
| DQM47_RS03965 (NCTC10876_00786) | - | 776041..776454 (+) | 414 | WP_085577344.1 | YopX family protein | - |
| DQM47_RS09865 (NCTC10876_00787) | - | 776451..776657 (+) | 207 | WP_085577345.1 | hypothetical protein | - |
| DQM47_RS03970 (NCTC10876_00788) | - | 776681..777121 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM47_RS03980 (NCTC10876_00789) | - | 777768..778106 (+) | 339 | WP_063632710.1 | HNH endonuclease | - |
| DQM47_RS03985 (NCTC10876_00790) | - | 778277..778744 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQM47_RS03990 (NCTC10876_00791) | - | 778747..778977 (+) | 231 | WP_085577347.1 | hypothetical protein | - |
| DQM47_RS03995 (NCTC10876_00792) | - | 778981..780735 (+) | 1755 | WP_063632717.1 | terminase large subunit | - |
| DQM47_RS09870 (NCTC10876_00793) | - | 780732..780902 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQM47_RS04000 (NCTC10876_00794) | - | 780895..781119 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQM47_RS04005 (NCTC10876_00795) | - | 781153..782373 (+) | 1221 | WP_011017578.1 | phage portal protein | - |
| DQM47_RS04010 (NCTC10876_00796) | - | 782351..783016 (+) | 666 | WP_032465106.1 | head maturation protease, ClpP-related | - |
| DQM47_RS04015 (NCTC10876_00797) | - | 783041..784228 (+) | 1188 | WP_011017580.1 | phage major capsid protein | - |
| DQM47_RS10110 | - | 784242..784370 (+) | 129 | WP_001118388.1 | hypothetical protein | - |
| DQM47_RS04020 (NCTC10876_00798) | - | 784373..784675 (+) | 303 | WP_063812171.1 | head-tail connector protein | - |
| DQM47_RS04025 (NCTC10876_00799) | - | 784672..785019 (+) | 348 | WP_063812172.1 | phage head closure protein | - |
| DQM47_RS04030 (NCTC10876_00800) | - | 785016..785393 (+) | 378 | WP_085577348.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM47_RS04035 (NCTC10876_00801) | - | 785390..785815 (+) | 426 | WP_011017584.1 | hypothetical protein | - |
| DQM47_RS04040 (NCTC10876_00802) | - | 785831..786439 (+) | 609 | WP_011017585.1 | major tail protein | - |
| DQM47_RS04045 (NCTC10876_00803) | gpG | 786492..786818 (+) | 327 | WP_011017586.1 | phage tail assembly chaperone G | - |
| DQM47_RS09875 | - | 786866..787015 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| DQM47_RS04050 (NCTC10876_00804) | - | 787028..790951 (+) | 3924 | WP_085577349.1 | phage tail tape measure protein | - |
| DQM47_RS04055 (NCTC10876_00805) | - | 790951..791658 (+) | 708 | WP_085577350.1 | distal tail protein Dit | - |
| DQM47_RS04060 (NCTC10876_00806) | - | 791655..793799 (+) | 2145 | WP_085577351.1 | phage tail spike protein | - |
| DQM47_RS04065 (NCTC10876_00807) | hylP | 793796..794809 (+) | 1014 | WP_111695808.1 | hyaluronidase HylP | - |
| DQM47_RS04070 (NCTC10876_00808) | - | 794824..796710 (+) | 1887 | WP_111695809.1 | gp58-like family protein | - |
| DQM47_RS04075 (NCTC10876_00809) | - | 796719..796880 (+) | 162 | WP_085577293.1 | hypothetical protein | - |
| DQM47_RS04080 (NCTC10876_00810) | - | 796883..797494 (+) | 612 | WP_085577294.1 | DUF1366 domain-containing protein | - |
| DQM47_RS04085 (NCTC10876_00811) | - | 797504..797776 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM47_RS04090 (NCTC10876_00812) | - | 797773..798000 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQM47_RS04095 (NCTC10876_00814) | - | 798117..799451 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DQM47_RS04100 (NCTC10876_00815) | speC | 799527..800234 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQM47_RS04105 (NCTC10876_00816) | mf2 | 800345..801103 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQM47_RS04110 (NCTC10876_00817) | prx | 801343..801531 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DQM47_RS04120 (NCTC10876_00819) | - | 802122..802736 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM47_RS04125 (NCTC10876_00820) | - | 802867..803652 (-) | 786 | WP_023078569.1 | hypothetical protein | - |
| DQM47_RS04130 (NCTC10876_00821) | - | 803662..804360 (-) | 699 | WP_023078568.1 | ABC transporter ATP-binding protein | - |
| DQM47_RS04135 (NCTC10876_00822) | - | 804360..804731 (-) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DQM47_RS04140 (NCTC10876_00823) | - | 804916..808026 (+) | 3111 | WP_023610966.1 | DNA polymerase III subunit alpha | - |
| DQM47_RS04145 (NCTC10876_00824) | pfkA | 808106..809119 (+) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=1138468 DQM47_RS04110 WP_002993136.1 801343..801531(+) (prx) [Streptococcus pyogenes strain NCTC10876]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1138468 DQM47_RS04110 WP_002993136.1 801343..801531(+) (prx) [Streptococcus pyogenes strain NCTC10876]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |