Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM46_RS05325 | Genome accession | NZ_LS483357 |
| Coordinates | 1038281..1038469 (-) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain NCTC8326 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1038281..1088091 | 1038281..1038469 | within | 0 |
Gene organization within MGE regions
Location: 1038281..1088091
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM46_RS05325 (NCTC8326_01062) | prx | 1038281..1038469 (-) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| DQM46_RS05330 (NCTC8326_01063) | sda3 | 1038707..1039507 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQM46_RS05335 (NCTC8326_01064) | - | 1039779..1040213 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQM46_RS05340 (NCTC8326_01065) | - | 1040282..1040941 (-) | 660 | WP_011528570.1 | hypothetical protein | - |
| DQM46_RS05345 (NCTC8326_01066) | - | 1040941..1041162 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQM46_RS05350 (NCTC8326_01067) | - | 1041172..1041945 (-) | 774 | WP_011528569.1 | hypothetical protein | - |
| DQM46_RS05355 (NCTC8326_01068) | - | 1041956..1042558 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQM46_RS05360 (NCTC8326_01069) | - | 1042570..1043334 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQM46_RS05365 (NCTC8326_01070) | - | 1043336..1043668 (-) | 333 | WP_011054798.1 | phage holin | - |
| DQM46_RS05370 (NCTC8326_01071) | - | 1043668..1043991 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQM46_RS10035 (NCTC8326_01072) | - | 1044005..1044127 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQM46_RS05375 (NCTC8326_01073) | - | 1044141..1044488 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQM46_RS05380 (NCTC8326_01074) | - | 1044499..1046361 (-) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| DQM46_RS05385 (NCTC8326_01075) | - | 1046366..1049815 (-) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| DQM46_RS05390 (NCTC8326_01076) | - | 1049816..1051300 (-) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| DQM46_RS05395 (NCTC8326_01077) | - | 1051301..1053106 (-) | 1806 | WP_111678884.1 | phage tail protein | - |
| DQM46_RS05400 (NCTC8326_01078) | - | 1053099..1053557 (-) | 459 | WP_011528564.1 | hypothetical protein | - |
| DQM46_RS05405 (NCTC8326_01079) | - | 1053530..1053847 (-) | 318 | WP_011528563.1 | hypothetical protein | - |
| DQM46_RS05410 (NCTC8326_01080) | - | 1053860..1054366 (-) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| DQM46_RS05415 (NCTC8326_01081) | - | 1054378..1054788 (-) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| DQM46_RS05420 (NCTC8326_01082) | - | 1054790..1055185 (-) | 396 | WP_011528560.1 | hypothetical protein | - |
| DQM46_RS05425 (NCTC8326_01083) | - | 1055182..1055493 (-) | 312 | WP_011528559.1 | hypothetical protein | - |
| DQM46_RS05430 (NCTC8326_01084) | - | 1055490..1055834 (-) | 345 | WP_011528558.1 | hypothetical protein | - |
| DQM46_RS05435 (NCTC8326_01085) | - | 1055848..1056141 (-) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| DQM46_RS05440 (NCTC8326_01086) | - | 1056153..1057043 (-) | 891 | WP_011528556.1 | hypothetical protein | - |
| DQM46_RS05445 (NCTC8326_01087) | - | 1057062..1057631 (-) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| DQM46_RS05450 (NCTC8326_01088) | - | 1057743..1057973 (-) | 231 | WP_011528554.1 | hypothetical protein | - |
| DQM46_RS05455 (NCTC8326_01089) | - | 1057980..1058888 (-) | 909 | WP_011528553.1 | minor capsid protein | - |
| DQM46_RS05460 (NCTC8326_01090) | - | 1058857..1060182 (-) | 1326 | WP_011528552.1 | phage portal protein | - |
| DQM46_RS05465 (NCTC8326_01091) | - | 1060182..1061456 (-) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| DQM46_RS05470 (NCTC8326_01092) | - | 1061446..1061826 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQM46_RS05475 | - | 1061913..1062131 (+) | 219 | WP_011528550.1 | hypothetical protein | - |
| DQM46_RS05485 (NCTC8326_01093) | - | 1062495..1062935 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM46_RS09820 (NCTC8326_01094) | - | 1063209..1063379 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| DQM46_RS05490 (NCTC8326_01095) | - | 1063376..1063882 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| DQM46_RS09825 (NCTC8326_01096) | - | 1063879..1064049 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| DQM46_RS05495 (NCTC8326_01097) | - | 1064046..1064450 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| DQM46_RS05500 (NCTC8326_01098) | - | 1064460..1064729 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQM46_RS05505 (NCTC8326_01099) | - | 1064726..1065010 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| DQM46_RS10085 (NCTC8326_01100) | - | 1065004..1065255 (-) | 252 | WP_011528549.1 | hypothetical protein | - |
| DQM46_RS05515 (NCTC8326_01101) | - | 1065252..1065608 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQM46_RS05520 (NCTC8326_01102) | - | 1065592..1065912 (-) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| DQM46_RS05525 (NCTC8326_01103) | - | 1066157..1067170 (-) | 1014 | WP_227875583.1 | phage/plasmid primase, P4 family | - |
| DQM46_RS10130 (NCTC8326_01104) | - | 1067083..1067637 (-) | 555 | WP_002995962.1 | hypothetical protein | - |
| DQM46_RS05530 (NCTC8326_01105) | - | 1067627..1068439 (-) | 813 | WP_011528547.1 | bifunctional DNA primase/polymerase | - |
| DQM46_RS05535 (NCTC8326_01106) | - | 1068442..1068900 (-) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| DQM46_RS05540 (NCTC8326_01107) | - | 1068916..1070145 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DQM46_RS05545 (NCTC8326_01108) | - | 1070247..1070927 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQM46_RS05550 (NCTC8326_01109) | - | 1070928..1071410 (-) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| DQM46_RS05555 (NCTC8326_01110) | - | 1071637..1071951 (-) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| DQM46_RS10040 (NCTC8326_01111) | - | 1071967..1072101 (-) | 135 | WP_011528543.1 | hypothetical protein | - |
| DQM46_RS05560 (NCTC8326_01112) | - | 1072132..1072383 (-) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| DQM46_RS05565 (NCTC8326_01113) | - | 1072478..1072696 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQM46_RS05570 (NCTC8326_01114) | - | 1072885..1073244 (+) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQM46_RS05575 (NCTC8326_01115) | - | 1073228..1073605 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM46_RS09830 (NCTC8326_01116) | - | 1073616..1073768 (+) | 153 | WP_172451528.1 | hypothetical protein | - |
| DQM46_RS05580 (NCTC8326_01117) | - | 1073939..1074625 (+) | 687 | WP_011528539.1 | hypothetical protein | - |
| DQM46_RS05585 (NCTC8326_01118) | - | 1074747..1075886 (+) | 1140 | WP_011528538.1 | tyrosine-type recombinase/integrase | - |
| DQM46_RS05590 (NCTC8326_01119) | rfbB | 1075969..1077009 (-) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| DQM46_RS05595 (NCTC8326_01120) | - | 1077253..1077846 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| DQM46_RS05600 (NCTC8326_01121) | rfbA | 1077846..1078715 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| DQM46_RS05605 (NCTC8326_01122) | - | 1078773..1079879 (-) | 1107 | WP_011528537.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| DQM46_RS05610 (NCTC8326_01123) | - | 1079919..1080707 (-) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| DQM46_RS05615 (NCTC8326_01124) | - | 1080697..1081383 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| DQM46_RS05620 (NCTC8326_01125) | nth | 1081455..1082111 (-) | 657 | WP_002990106.1 | endonuclease III | - |
| DQM46_RS05625 (NCTC8326_01126) | - | 1082108..1082791 (-) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| DQM46_RS05630 (NCTC8326_01127) | - | 1082872..1083390 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| DQM46_RS05635 (NCTC8326_01128) | recJ | 1083541..1085751 (-) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| DQM46_RS05640 (NCTC8326_01129) | - | 1085748..1086512 (-) | 765 | WP_002984893.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| DQM46_RS05645 (NCTC8326_01130) | rnz | 1086512..1087441 (-) | 930 | WP_009881223.1 | ribonuclease Z | - |
| DQM46_RS05650 (NCTC8326_01131) | - | 1087456..1088091 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=1138335 DQM46_RS05325 WP_011528571.1 1038281..1038469(-) (prx) [Streptococcus pyogenes strain NCTC8326]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=1138335 DQM46_RS05325 WP_011528571.1 1038281..1038469(-) (prx) [Streptococcus pyogenes strain NCTC8326]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |