Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM46_RS03515 | Genome accession | NZ_LS483357 |
| Coordinates | 658988..659170 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain NCTC8326 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623486..659170 | 658988..659170 | within | 0 |
Gene organization within MGE regions
Location: 623486..659170
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM46_RS03250 (NCTC8326_00640) | - | 623486..623761 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQM46_RS03255 (NCTC8326_00641) | - | 623850..624992 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM46_RS03260 (NCTC8326_00642) | - | 625116..625634 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| DQM46_RS03265 (NCTC8326_00643) | - | 625646..626401 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQM46_RS03270 (NCTC8326_00644) | - | 626603..626815 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQM46_RS03275 (NCTC8326_00646) | - | 627085..627396 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQM46_RS03280 (NCTC8326_00647) | - | 627398..627583 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQM46_RS09910 | - | 627677..627946 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQM46_RS03290 (NCTC8326_00648) | - | 628087..628473 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQM46_RS03295 (NCTC8326_00649) | - | 628454..628687 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQM46_RS03300 (NCTC8326_00650) | - | 628684..628824 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQM46_RS03305 (NCTC8326_00651) | - | 628833..629039 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQM46_RS03310 (NCTC8326_00652) | - | 629095..629424 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| DQM46_RS03315 (NCTC8326_00653) | - | 629427..630353 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQM46_RS03320 (NCTC8326_00654) | - | 630350..630550 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQM46_RS03325 (NCTC8326_00655) | - | 630543..631340 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQM46_RS03330 (NCTC8326_00657) | - | 631705..632100 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQM46_RS03335 (NCTC8326_00658) | - | 632097..633443 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DQM46_RS03340 (NCTC8326_00659) | - | 633454..633786 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQM46_RS03345 (NCTC8326_00660) | - | 633783..634295 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQM46_RS03350 (NCTC8326_00661) | - | 634331..634648 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQM46_RS09780 (NCTC8326_00662) | - | 634645..634800 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQM46_RS03355 (NCTC8326_00663) | - | 634797..635048 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQM46_RS03360 (NCTC8326_00664) | - | 635124..635543 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DQM46_RS03365 | - | 635651..635995 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQM46_RS03370 (NCTC8326_00665) | - | 636143..636499 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQM46_RS03375 (NCTC8326_00666) | - | 636496..637764 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQM46_RS03380 (NCTC8326_00667) | - | 637757..639250 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQM46_RS03385 (NCTC8326_00668) | - | 639256..639480 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQM46_RS03390 (NCTC8326_00669) | - | 639532..639798 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DQM46_RS03395 | - | 639800..640036 (+) | 237 | Protein_587 | hypothetical protein | - |
| DQM46_RS03400 (NCTC8326_00670) | - | 640118..641533 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| DQM46_RS03405 (NCTC8326_00671) | - | 641613..642074 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQM46_RS03410 (NCTC8326_00672) | - | 642099..643010 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| DQM46_RS03415 (NCTC8326_00673) | - | 643010..643210 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQM46_RS03420 (NCTC8326_00674) | - | 643220..643642 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQM46_RS03425 (NCTC8326_00675) | - | 643602..643940 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQM46_RS03430 (NCTC8326_00676) | - | 643933..644169 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQM46_RS03435 (NCTC8326_00677) | - | 644170..644505 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| DQM46_RS03440 (NCTC8326_00678) | - | 644517..645095 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| DQM46_RS03445 (NCTC8326_00679) | - | 645106..645369 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| DQM46_RS03450 (NCTC8326_00680) | - | 645384..645755 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| DQM46_RS03455 (NCTC8326_00681) | - | 645755..648112 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| DQM46_RS03460 (NCTC8326_00682) | - | 648109..648804 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQM46_RS03465 (NCTC8326_00683) | - | 648786..650762 (+) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| DQM46_RS03470 (NCTC8326_00684) | hylP | 650759..651874 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| DQM46_RS03475 (NCTC8326_00685) | - | 651889..653669 (+) | 1781 | Protein_603 | gp58-like family protein | - |
| DQM46_RS03480 (NCTC8326_00687) | - | 653678..654106 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DQM46_RS03485 (NCTC8326_00688) | - | 654109..654741 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| DQM46_RS03490 (NCTC8326_00689) | - | 654753..655025 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM46_RS03495 (NCTC8326_00690) | - | 655022..655249 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQM46_RS03500 (NCTC8326_00692) | - | 655368..656585 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| DQM46_RS03505 (NCTC8326_00693) | - | 656721..657845 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| DQM46_RS03510 (NCTC8326_00694) | entC3 | 658093..658875 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| DQM46_RS03515 (NCTC8326_00695) | prx | 658988..659170 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=1138329 DQM46_RS03515 WP_011528776.1 658988..659170(+) (prx) [Streptococcus pyogenes strain NCTC8326]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1138329 DQM46_RS03515 WP_011528776.1 658988..659170(+) (prx) [Streptococcus pyogenes strain NCTC8326]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |