Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM51_RS06420 | Genome accession | NZ_LS483356 |
| Coordinates | 1216544..1216726 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8230 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1216544..1254449 | 1216544..1216726 | within | 0 |
Gene organization within MGE regions
Location: 1216544..1254449
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM51_RS06420 (NCTC8230_01282) | prx | 1216544..1216726 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| DQM51_RS06425 (NCTC8230_01283) | sda3 | 1216965..1217765 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQM51_RS06430 (NCTC8230_01284) | - | 1218036..1218470 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| DQM51_RS06435 (NCTC8230_01285) | - | 1218540..1219748 (-) | 1209 | WP_111713311.1 | glucosaminidase domain-containing protein | - |
| DQM51_RS06440 (NCTC8230_01286) | - | 1219864..1220091 (-) | 228 | WP_000609113.1 | phage holin | - |
| DQM51_RS06445 (NCTC8230_01287) | - | 1220088..1220363 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQM51_RS06450 (NCTC8230_01288) | - | 1220373..1220990 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| DQM51_RS06455 (NCTC8230_01289) | - | 1220993..1221424 (-) | 432 | WP_111713312.1 | DUF1617 family protein | - |
| DQM51_RS06460 (NCTC8230_01290) | - | 1221436..1223220 (-) | 1785 | WP_111713313.1 | gp58-like family protein | - |
| DQM51_RS06465 (NCTC8230_01291) | - | 1223235..1224236 (-) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| DQM51_RS06470 (NCTC8230_01292) | - | 1224236..1226194 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| DQM51_RS06475 (NCTC8230_01293) | - | 1226191..1226886 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| DQM51_RS06480 (NCTC8230_01294) | - | 1226883..1229240 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| DQM51_RS06485 | - | 1229240..1229611 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| DQM51_RS06490 | - | 1229633..1229890 (-) | 258 | Protein_1219 | hypothetical protein | - |
| DQM51_RS06495 (NCTC8230_01296) | - | 1229901..1230494 (-) | 594 | WP_111713314.1 | phage tail protein | - |
| DQM51_RS06500 (NCTC8230_01297) | - | 1230506..1230841 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQM51_RS06505 (NCTC8230_01298) | - | 1230842..1231078 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| DQM51_RS06510 (NCTC8230_01299) | - | 1231071..1231409 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| DQM51_RS06515 (NCTC8230_01300) | - | 1231369..1231791 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQM51_RS06520 (NCTC8230_01301) | - | 1231801..1232001 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQM51_RS06525 | - | 1232001..1232913 (-) | 913 | Protein_1226 | phage major capsid protein | - |
| DQM51_RS06530 (NCTC8230_01304) | - | 1232938..1233399 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQM51_RS06535 (NCTC8230_01305) | - | 1233480..1234895 (-) | 1416 | WP_011285619.1 | terminase | - |
| DQM51_RS06540 (NCTC8230_01306) | - | 1235005..1235271 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| DQM51_RS06545 (NCTC8230_01307) | - | 1235264..1235443 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| DQM51_RS06550 (NCTC8230_01308) | - | 1235493..1235717 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| DQM51_RS06555 (NCTC8230_01309) | - | 1235723..1237216 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQM51_RS06560 (NCTC8230_01310) | - | 1237209..1238477 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQM51_RS06565 (NCTC8230_01311) | - | 1238474..1238830 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQM51_RS06570 | - | 1238979..1239323 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| DQM51_RS06575 (NCTC8230_01312) | - | 1239432..1239851 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| DQM51_RS06580 (NCTC8230_01313) | - | 1240119..1240754 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| DQM51_RS06585 (NCTC8230_01314) | - | 1240756..1241025 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| DQM51_RS06590 (NCTC8230_01315) | - | 1241109..1241621 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| DQM51_RS06595 (NCTC8230_01316) | - | 1241618..1241959 (-) | 342 | WP_020837403.1 | hypothetical protein | - |
| DQM51_RS10265 (NCTC8230_01317) | - | 1242137..1242304 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| DQM51_RS06600 (NCTC8230_01318) | - | 1242314..1243111 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQM51_RS06605 (NCTC8230_01319) | - | 1243108..1244037 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| DQM51_RS06610 (NCTC8230_01320) | - | 1244040..1244369 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| DQM51_RS06615 (NCTC8230_01321) | - | 1244425..1244631 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| DQM51_RS06620 (NCTC8230_01322) | - | 1244640..1244780 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| DQM51_RS06625 (NCTC8230_01323) | - | 1244777..1245010 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| DQM51_RS06630 (NCTC8230_01324) | - | 1244991..1245380 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| DQM51_RS10450 | - | 1245525..1245764 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| DQM51_RS06640 (NCTC8230_01325) | - | 1245864..1246049 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| DQM51_RS06645 (NCTC8230_01326) | - | 1246051..1246362 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| DQM51_RS06650 (NCTC8230_01327) | - | 1246440..1246625 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM51_RS06655 (NCTC8230_01328) | - | 1246792..1247031 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQM51_RS06660 (NCTC8230_01329) | - | 1247173..1247979 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQM51_RS06665 (NCTC8230_01330) | - | 1247914..1248180 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| DQM51_RS06670 (NCTC8230_01331) | - | 1248212..1248928 (-) | 717 | WP_111713315.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM51_RS06675 (NCTC8230_01332) | - | 1248940..1249131 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQM51_RS06680 | - | 1249767..1249862 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQM51_RS06685 (NCTC8230_01334) | - | 1250285..1250632 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| DQM51_RS06690 (NCTC8230_01335) | - | 1250636..1251016 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM51_RS06695 (NCTC8230_01336) | - | 1251028..1251294 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| DQM51_RS06700 (NCTC8230_01337) | - | 1251418..1252560 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM51_RS06705 (NCTC8230_01338) | - | 1252650..1252925 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQM51_RS06710 (NCTC8230_01339) | - | 1253024..1253611 (-) | 588 | WP_111713316.1 | YpmS family protein | - |
| DQM51_RS06715 (NCTC8230_01340) | - | 1253589..1254431 (-) | 843 | WP_172450323.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1138282 DQM51_RS06420 WP_011017964.1 1216544..1216726(-) (prx) [Streptococcus pyogenes strain NCTC8230]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1138282 DQM51_RS06420 WP_011017964.1 1216544..1216726(-) (prx) [Streptococcus pyogenes strain NCTC8230]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |