Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL39_RS02500 | Genome accession | NZ_LS483353 |
| Coordinates | 466748..466930 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC4001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 466629..515154 | 466748..466930 | within | 0 |
Gene organization within MGE regions
Location: 466629..515154
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL39_RS02500 (NCTC4001_00494) | prx | 466748..466930 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| DQL39_RS02505 (NCTC4001_00495) | cadA | 467460..468740 (+) | 1281 | WP_111718056.1 | cadmium family heavy metal-translocating P-type ATPase | - |
| DQL39_RS02510 (NCTC4001_00496) | - | 469040..469975 (-) | 936 | WP_010922443.1 | dihydroorotate oxidase | - |
| DQL39_RS02515 (NCTC4001_00497) | - | 470214..470909 (+) | 696 | WP_002983928.1 | phosphoglycerate mutase | - |
| DQL39_RS02520 (NCTC4001_00498) | - | 471016..471537 (+) | 522 | WP_011017960.1 | transcription repressor NadR | - |
| DQL39_RS02525 (NCTC4001_00499) | - | 471698..472240 (+) | 543 | WP_011017959.1 | hypothetical protein | - |
| DQL39_RS02530 (NCTC4001_00500) | - | 472364..473143 (+) | 780 | WP_038433256.1 | formate/nitrite transporter family protein | - |
| DQL39_RS09340 | - | 473703..473885 (+) | 183 | WP_011888786.1 | penicillin-binding protein | - |
| DQL39_RS02540 (NCTC4001_00501) | recR | 473932..474528 (+) | 597 | WP_011888787.1 | recombination mediator RecR | - |
| DQL39_RS02545 (NCTC4001_00502) | - | 474629..475675 (+) | 1047 | WP_011017958.1 | D-alanine--D-alanine ligase | - |
| DQL39_RS02550 (NCTC4001_00503) | - | 475874..477265 (+) | 1392 | WP_010922441.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| DQL39_RS02555 (NCTC4001_00504) | - | 477345..478040 (+) | 696 | WP_038433259.1 | TIGR02206 family membrane protein | - |
| DQL39_RS02565 (NCTC4001_00505) | - | 478288..479832 (+) | 1545 | WP_002989155.1 | peptide chain release factor 3 | - |
| DQL39_RS02570 (NCTC4001_00506) | - | 480139..481758 (+) | 1620 | WP_038433260.1 | DEAD/DEAH box helicase | - |
| DQL39_RS02575 (NCTC4001_00507) | - | 481885..483885 (+) | 2001 | WP_111718057.1 | potassium transporter Kup | - |
| DQL39_RS02580 (NCTC4001_00508) | - | 483909..484187 (-) | 279 | WP_003061674.1 | GIY-YIG nuclease family protein | - |
| DQL39_RS02585 (NCTC4001_00509) | - | 484177..484953 (-) | 777 | WP_080286812.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| DQL39_RS02590 (NCTC4001_00510) | - | 485071..485811 (+) | 741 | WP_022554937.1 | lysophospholipid acyltransferase family protein | - |
| DQL39_RS02595 (NCTC4001_00512) | - | 486010..486673 (+) | 664 | Protein_469 | helix-hairpin-helix domain-containing protein | - |
| DQL39_RS02600 (NCTC4001_00513) | - | 486654..488897 (+) | 2244 | WP_038433267.1 | DNA internalization-related competence protein ComEC/Rec2 | - |
| DQL39_RS02605 (NCTC4001_00514) | holA | 488968..490008 (+) | 1041 | WP_011888795.1 | DNA polymerase III subunit delta | - |
| DQL39_RS02610 (NCTC4001_00515) | sodA | 490105..490710 (+) | 606 | WP_002983977.1 | superoxide dismutase SodA | - |
| DQL39_RS02615 (NCTC4001_00516) | - | 490787..491767 (-) | 981 | WP_038433269.1 | IS30-like element IS1239 family transposase | - |
| DQL39_RS02620 (NCTC4001_00517) | - | 491963..492190 (+) | 228 | WP_011054657.1 | hypothetical protein | - |
| DQL39_RS02630 (NCTC4001_00520) | - | 492175..492997 (+) | 823 | Protein_475 | serine hydrolase | - |
| DQL39_RS02635 (NCTC4001_00521) | - | 493111..494331 (-) | 1221 | WP_010922430.1 | DUF3114 domain-containing protein | - |
| DQL39_RS02640 (NCTC4001_00522) | queA | 494338..495366 (-) | 1029 | WP_011284937.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
| DQL39_RS02645 (NCTC4001_00523) | nagB | 495568..496317 (+) | 750 | WP_011888796.1 | glucosamine-6-phosphate deaminase | - |
| DQL39_RS02650 (NCTC4001_00524) | - | 496391..497107 (+) | 717 | WP_002995774.1 | pseudouridine synthase | - |
| DQL39_RS02655 (NCTC4001_00525) | - | 497402..498364 (+) | 963 | WP_023078855.1 | competence protein CoiA | - |
| DQL39_RS02660 (NCTC4001_00526) | pepF | 498377..500182 (+) | 1806 | WP_038433275.1 | oligoendopeptidase F | Regulator |
| DQL39_RS02665 (NCTC4001_00527) | - | 500555..501751 (+) | 1197 | WP_038433276.1 | OFA family MFS transporter | - |
| DQL39_RS02670 (NCTC4001_00528) | - | 501817..502524 (+) | 708 | WP_002984000.1 | O-methyltransferase | - |
| DQL39_RS02675 (NCTC4001_00529) | prsA | 502587..503642 (+) | 1056 | WP_038433277.1 | peptidylprolyl isomerase PrsA | - |
| DQL39_RS02680 (NCTC4001_00531) | alaS | 504029..506647 (+) | 2619 | WP_111718058.1 | alanine--tRNA ligase | - |
| DQL39_RS02685 (NCTC4001_00532) | - | 507007..507222 (+) | 216 | WP_030127117.1 | helix-turn-helix transcriptional regulator | - |
| DQL39_RS02690 (NCTC4001_00533) | - | 507219..507980 (+) | 762 | WP_011184659.1 | DUF3169 family protein | - |
| DQL39_RS02695 (NCTC4001_00534) | - | 507999..508694 (+) | 696 | WP_011888803.1 | CPBP family intramembrane glutamic endopeptidase | - |
| DQL39_RS02700 | - | 508792..509942 (-) | 1151 | Protein_489 | IS3 family transposase | - |
| DQL39_RS02705 | - | 510038..511265 (-) | 1228 | Protein_490 | chloride channel protein | - |
| DQL39_RS02710 (NCTC4001_00540) | nrdF | 511327..512286 (-) | 960 | WP_038433284.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| DQL39_RS02715 (NCTC4001_00541) | nrdE | 512490..514649 (-) | 2160 | WP_038433286.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| DQL39_RS02720 (NCTC4001_00542) | - | 514669..514887 (-) | 219 | WP_002989242.1 | redoxin NrdH | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1138088 DQL39_RS02500 WP_011017964.1 466748..466930(+) (prx) [Streptococcus pyogenes strain NCTC4001]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1138088 DQL39_RS02500 WP_011017964.1 466748..466930(+) (prx) [Streptococcus pyogenes strain NCTC4001]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |