Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL37_RS06175 | Genome accession | NZ_LS483352 |
| Coordinates | 1179950..1180132 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain NCTC12052 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1179950..1216741 | 1179950..1180132 | within | 0 |
Gene organization within MGE regions
Location: 1179950..1216741
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL37_RS06175 (NCTC12052_01230) | prx | 1179950..1180132 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| DQL37_RS06180 (NCTC12052_01231) | mf2 | 1180372..1181130 (+) | 759 | WP_014635573.1 | DNase Mf2 | - |
| DQL37_RS06185 (NCTC12052_01232) | speC | 1181241..1181948 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL37_RS06190 (NCTC12052_01233) | - | 1182017..1183234 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| DQL37_RS06195 (NCTC12052_01235) | - | 1183353..1183580 (-) | 228 | WP_003058873.1 | phage holin | - |
| DQL37_RS06200 (NCTC12052_01236) | - | 1183577..1183849 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQL37_RS06205 (NCTC12052_01237) | - | 1183861..1184493 (-) | 633 | WP_111685784.1 | hypothetical protein | - |
| DQL37_RS06210 (NCTC12052_01238) | - | 1184496..1184924 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DQL37_RS06215 (NCTC12052_01239) | - | 1184933..1186714 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| DQL37_RS06220 (NCTC12052_01240) | hylP | 1186729..1187742 (-) | 1014 | WP_111685785.1 | hyaluronidase HylP | - |
| DQL37_RS06225 (NCTC12052_01241) | - | 1187742..1189715 (-) | 1974 | WP_168388764.1 | phage tail spike protein | - |
| DQL37_RS06230 (NCTC12052_01242) | - | 1189697..1190392 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQL37_RS06235 (NCTC12052_01243) | - | 1190389..1192752 (-) | 2364 | WP_111685787.1 | hypothetical protein | - |
| DQL37_RS06240 (NCTC12052_01244) | - | 1192752..1193123 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| DQL37_RS06245 (NCTC12052_01245) | - | 1193138..1193401 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQL37_RS06250 (NCTC12052_01246) | - | 1193412..1194002 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| DQL37_RS06255 (NCTC12052_01247) | - | 1194018..1194353 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQL37_RS06260 (NCTC12052_01248) | - | 1194354..1194590 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQL37_RS06265 (NCTC12052_01249) | - | 1194583..1194921 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQL37_RS06270 (NCTC12052_01250) | - | 1194881..1195303 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL37_RS06275 (NCTC12052_01251) | - | 1195313..1195513 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQL37_RS06280 (NCTC12052_01252) | - | 1195513..1196424 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| DQL37_RS06285 (NCTC12052_01253) | - | 1196449..1196910 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQL37_RS06290 (NCTC12052_01254) | - | 1196991..1198406 (-) | 1416 | WP_011054685.1 | terminase | - |
| DQL37_RS06295 (NCTC12052_01255) | - | 1198488..1198703 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| DQL37_RS06300 (NCTC12052_01256) | - | 1198705..1198971 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQL37_RS09740 (NCTC12052_01257) | - | 1198964..1199116 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| DQL37_RS06305 (NCTC12052_01258) | - | 1199193..1199417 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQL37_RS06310 (NCTC12052_01259) | - | 1199423..1200916 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQL37_RS06315 (NCTC12052_01260) | - | 1200909..1202177 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQL37_RS06320 (NCTC12052_01261) | - | 1202174..1202530 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQL37_RS06325 | - | 1202678..1203022 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQL37_RS06330 (NCTC12052_01262) | - | 1203130..1203549 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DQL37_RS06335 (NCTC12052_01263) | - | 1203625..1203876 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQL37_RS09745 (NCTC12052_01264) | - | 1203873..1204028 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQL37_RS06340 (NCTC12052_01265) | - | 1204025..1204342 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQL37_RS06345 (NCTC12052_01266) | - | 1204378..1204890 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQL37_RS06350 (NCTC12052_01267) | - | 1204887..1205219 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQL37_RS06355 (NCTC12052_01268) | - | 1205230..1206576 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DQL37_RS06360 (NCTC12052_01269) | - | 1206573..1206968 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQL37_RS06365 (NCTC12052_01271) | - | 1207333..1208130 (-) | 798 | WP_111685788.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQL37_RS06370 (NCTC12052_01272) | - | 1208123..1208323 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQL37_RS06375 (NCTC12052_01273) | - | 1208320..1209246 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQL37_RS06380 (NCTC12052_01274) | - | 1209249..1209578 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| DQL37_RS06385 (NCTC12052_01275) | - | 1209634..1209840 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQL37_RS06390 (NCTC12052_01276) | - | 1209849..1209989 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQL37_RS06395 (NCTC12052_01277) | - | 1209986..1210219 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQL37_RS06400 (NCTC12052_01278) | - | 1210200..1210586 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQL37_RS09895 | - | 1210757..1211026 (-) | 270 | WP_011106700.1 | replication protein | - |
| DQL37_RS06410 (NCTC12052_01279) | - | 1211120..1211305 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQL37_RS06415 (NCTC12052_01280) | - | 1211307..1211618 (-) | 312 | WP_010922478.1 | excisionase | - |
| DQL37_RS06420 (NCTC12052_01282) | - | 1211888..1212100 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS06425 (NCTC12052_01283) | - | 1212302..1213057 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS06430 (NCTC12052_01284) | - | 1213069..1213587 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQL37_RS06435 (NCTC12052_01285) | - | 1213711..1214853 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL37_RS06440 (NCTC12052_01286) | - | 1214942..1215217 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL37_RS06445 (NCTC12052_01287) | - | 1215316..1215903 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQL37_RS06450 (NCTC12052_01288) | - | 1215881..1216723 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=1138056 DQL37_RS06175 WP_014635572.1 1179950..1180132(-) (prx) [Streptococcus pyogenes strain NCTC12052]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1138056 DQL37_RS06175 WP_014635572.1 1179950..1180132(-) (prx) [Streptococcus pyogenes strain NCTC12052]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |