Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL37_RS05340 | Genome accession | NZ_LS483352 |
| Coordinates | 1019045..1019233 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain NCTC12052 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1018875..1060919 | 1019045..1019233 | within | 0 |
Gene organization within MGE regions
Location: 1018875..1060919
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL37_RS05340 (NCTC12052_01053) | prx | 1019045..1019233 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| DQL37_RS05345 (NCTC12052_01054) | spel | 1019348..1020136 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| DQL37_RS05350 (NCTC12052_01055) | spem | 1020418..1021131 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| DQL37_RS05355 (NCTC12052_01056) | - | 1021515..1022075 (-) | 561 | WP_231907100.1 | GNAT family N-acetyltransferase | - |
| DQL37_RS05360 (NCTC12052_01057) | - | 1022108..1022272 (-) | 165 | WP_231907101.1 | hypothetical protein | - |
| DQL37_RS05365 (NCTC12052_01058) | - | 1022421..1023062 (-) | 642 | Protein_993 | CHAP domain-containing protein | - |
| DQL37_RS05370 (NCTC12052_01059) | - | 1023175..1023867 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| DQL37_RS05375 (NCTC12052_01060) | - | 1024103..1024657 (-) | 555 | Protein_995 | glycoside hydrolase family 73 protein | - |
| DQL37_RS05380 (NCTC12052_01062) | - | 1024773..1025000 (-) | 228 | WP_003058873.1 | phage holin | - |
| DQL37_RS05385 (NCTC12052_01063) | - | 1024997..1025272 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQL37_RS05390 (NCTC12052_01064) | - | 1025282..1025899 (-) | 618 | WP_111685762.1 | hypothetical protein | - |
| DQL37_RS05395 (NCTC12052_01065) | - | 1025902..1026330 (-) | 429 | WP_023079239.1 | DUF1617 family protein | - |
| DQL37_RS05400 | - | 1026342..1028247 (-) | 1906 | Protein_1000 | gp58-like family protein | - |
| DQL37_RS05405 (NCTC12052_01068) | hylP | 1028262..1029275 (-) | 1014 | Protein_1001 | hyaluronidase HylP | - |
| DQL37_RS05410 (NCTC12052_01069) | - | 1029272..1031416 (-) | 2145 | WP_111685763.1 | phage tail spike protein | - |
| DQL37_RS05415 (NCTC12052_01070) | - | 1031413..1032120 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DQL37_RS05420 (NCTC12052_01071) | - | 1032120..1036043 (-) | 3924 | WP_111685764.1 | phage tail tape measure protein | - |
| DQL37_RS09715 (NCTC12052_01072) | - | 1036056..1036223 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| DQL37_RS05425 (NCTC12052_01073) | gpG | 1036253..1036579 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DQL37_RS05430 (NCTC12052_01074) | - | 1036632..1037240 (-) | 609 | WP_014411858.1 | major tail protein | - |
| DQL37_RS05435 (NCTC12052_01075) | - | 1037257..1037682 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| DQL37_RS05440 (NCTC12052_01076) | - | 1037679..1038056 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL37_RS05445 (NCTC12052_01077) | - | 1038053..1038400 (-) | 348 | WP_063632712.1 | phage head closure protein | - |
| DQL37_RS05450 (NCTC12052_01078) | - | 1038397..1038699 (-) | 303 | WP_063631325.1 | head-tail connector protein | - |
| DQL37_RS05455 (NCTC12052_01079) | - | 1038835..1040037 (-) | 1203 | WP_023610889.1 | phage major capsid protein | - |
| DQL37_RS05460 (NCTC12052_01080) | - | 1040063..1040728 (-) | 666 | WP_063631324.1 | head maturation protease, ClpP-related | - |
| DQL37_RS05465 (NCTC12052_01081) | - | 1040706..1041926 (-) | 1221 | WP_063631323.1 | phage portal protein | - |
| DQL37_RS05470 (NCTC12052_01082) | - | 1041960..1042184 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQL37_RS09720 (NCTC12052_01083) | - | 1042177..1042347 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQL37_RS05475 (NCTC12052_01084) | - | 1042344..1044098 (-) | 1755 | WP_063632717.1 | terminase large subunit | - |
| DQL37_RS05480 (NCTC12052_01085) | - | 1044102..1044332 (-) | 231 | WP_085577347.1 | hypothetical protein | - |
| DQL37_RS05485 (NCTC12052_01086) | - | 1044335..1044802 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQL37_RS05490 (NCTC12052_01087) | - | 1044973..1045311 (-) | 339 | WP_063632710.1 | HNH endonuclease | - |
| DQL37_RS05495 (NCTC12052_01088) | - | 1045561..1046001 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL37_RS05500 (NCTC12052_01089) | - | 1046274..1046909 (-) | 636 | WP_111685765.1 | N-6 DNA methylase | - |
| DQL37_RS09875 (NCTC12052_01090) | - | 1046909..1047112 (-) | 204 | WP_231907102.1 | hypothetical protein | - |
| DQL37_RS09880 (NCTC12052_01091) | - | 1047164..1047310 (-) | 147 | WP_228549911.1 | hypothetical protein | - |
| DQL37_RS05510 (NCTC12052_01092) | - | 1047408..1047635 (-) | 228 | WP_111685766.1 | hypothetical protein | - |
| DQL37_RS05515 (NCTC12052_01093) | - | 1047639..1048061 (-) | 423 | WP_111685767.1 | hypothetical protein | - |
| DQL37_RS05520 (NCTC12052_01094) | - | 1048045..1048329 (-) | 285 | WP_231907103.1 | VRR-NUC domain-containing protein | - |
| DQL37_RS05525 (NCTC12052_01095) | - | 1048349..1049218 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DQL37_RS05530 (NCTC12052_01096) | - | 1049487..1051040 (-) | 1554 | WP_011017876.1 | hypothetical protein | - |
| DQL37_RS05535 (NCTC12052_01097) | - | 1051058..1051540 (-) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| DQL37_RS05540 (NCTC12052_01098) | - | 1051545..1052978 (-) | 1434 | Protein_1031 | DEAD/DEAH box helicase | - |
| DQL37_RS05545 (NCTC12052_01099) | - | 1052984..1053667 (-) | 684 | WP_014635524.1 | AAA family ATPase | - |
| DQL37_RS05550 (NCTC12052_01100) | - | 1053664..1053948 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| DQL37_RS05555 (NCTC12052_01101) | - | 1053945..1054139 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQL37_RS05560 (NCTC12052_01102) | - | 1054139..1054468 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| DQL37_RS05565 (NCTC12052_01104) | - | 1054549..1054686 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| DQL37_RS05570 (NCTC12052_01105) | - | 1054683..1054979 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQL37_RS05575 (NCTC12052_01106) | - | 1055058..1055243 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS05580 (NCTC12052_01107) | - | 1055410..1055649 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQL37_RS05585 (NCTC12052_01108) | - | 1055799..1056008 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQL37_RS05595 (NCTC12052_01110) | - | 1056224..1056463 (-) | 240 | WP_021340169.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS05600 (NCTC12052_01111) | - | 1056537..1057019 (+) | 483 | WP_231907104.1 | hypothetical protein | - |
| DQL37_RS09725 (NCTC12052_01112) | - | 1057016..1057162 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| DQL37_RS05605 (NCTC12052_01113) | - | 1057219..1058004 (+) | 786 | WP_085577339.1 | hypothetical protein | - |
| DQL37_RS05610 (NCTC12052_01115) | - | 1058138..1058296 (-) | 159 | WP_080465047.1 | hypothetical protein | - |
| DQL37_RS05615 (NCTC12052_01116) | - | 1058470..1059258 (+) | 789 | WP_021340822.1 | S24 family peptidase | - |
| DQL37_RS05620 (NCTC12052_01117) | - | 1059268..1059573 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DQL37_RS05625 (NCTC12052_01118) | - | 1059693..1060781 (+) | 1089 | WP_023079773.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1138053 DQL37_RS05340 WP_011054546.1 1019045..1019233(-) (prx) [Streptococcus pyogenes strain NCTC12052]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1138053 DQL37_RS05340 WP_011054546.1 1019045..1019233(-) (prx) [Streptococcus pyogenes strain NCTC12052]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |