Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL37_RS03305 | Genome accession | NZ_LS483352 |
| Coordinates | 600952..601131 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12052 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 554841..604475 | 600952..601131 | within | 0 |
Gene organization within MGE regions
Location: 554841..604475
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL37_RS03000 (NCTC12052_00588) | - | 554841..555782 (-) | 942 | WP_002990475.1 | DHH family phosphoesterase | - |
| DQL37_RS03005 (NCTC12052_00589) | - | 556176..556625 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| DQL37_RS03010 (NCTC12052_00590) | - | 556809..557093 (+) | 285 | WP_010922101.1 | chorismate mutase | - |
| DQL37_RS03015 (NCTC12052_00591) | - | 557086..558348 (+) | 1263 | WP_109828710.1 | voltage-gated chloride channel family protein | - |
| DQL37_RS03020 (NCTC12052_00592) | rplS | 558463..558810 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| DQL37_RS03030 (NCTC12052_00594) | - | 559174..560250 (-) | 1077 | WP_111685702.1 | tyrosine-type recombinase/integrase | - |
| DQL37_RS03035 (NCTC12052_00595) | - | 560369..560890 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| DQL37_RS03040 (NCTC12052_00596) | - | 560901..561278 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL37_RS03045 (NCTC12052_00597) | - | 561262..561621 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS03050 (NCTC12052_00598) | - | 561809..562027 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| DQL37_RS03055 (NCTC12052_00599) | - | 562127..562357 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| DQL37_RS09700 (NCTC12052_00600) | - | 562341..562484 (+) | 144 | WP_164492191.1 | hypothetical protein | - |
| DQL37_RS03060 (NCTC12052_00601) | - | 562494..562712 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| DQL37_RS03065 (NCTC12052_00602) | - | 562714..562956 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| DQL37_RS03070 (NCTC12052_00603) | - | 562940..564259 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| DQL37_RS03075 (NCTC12052_00604) | - | 564274..565356 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| DQL37_RS09970 (NCTC12052_00605) | - | 565395..565529 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| DQL37_RS03080 (NCTC12052_00606) | - | 565551..566144 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| DQL37_RS03085 (NCTC12052_00607) | - | 566144..567727 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| DQL37_RS03090 (NCTC12052_00608) | - | 567740..567934 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| DQL37_RS03095 (NCTC12052_00609) | - | 567957..570200 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| DQL37_RS03100 (NCTC12052_00610) | - | 570492..570674 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| DQL37_RS03105 (NCTC12052_00611) | - | 570667..571062 (+) | 396 | WP_111685703.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL37_RS03110 (NCTC12052_00612) | - | 571059..571280 (+) | 222 | WP_010922069.1 | hypothetical protein | - |
| DQL37_RS03115 (NCTC12052_00613) | - | 571283..571555 (+) | 273 | WP_111685704.1 | hypothetical protein | - |
| DQL37_RS03120 (NCTC12052_00614) | - | 571559..572041 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| DQL37_RS03125 (NCTC12052_00615) | - | 572031..572795 (+) | 765 | WP_021299463.1 | DNA-methyltransferase | - |
| DQL37_RS03130 (NCTC12052_00616) | - | 572886..573179 (+) | 294 | WP_111685705.1 | hypothetical protein | - |
| DQL37_RS03140 (NCTC12052_00618) | - | 573635..574072 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| DQL37_RS03145 (NCTC12052_00619) | - | 574406..575572 (+) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| DQL37_RS03150 (NCTC12052_00620) | - | 575915..576391 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| DQL37_RS03155 (NCTC12052_00621) | - | 576474..577685 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DQL37_RS03160 (NCTC12052_00622) | - | 577699..579201 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| DQL37_RS03165 (NCTC12052_00623) | - | 579206..580699 (+) | 1494 | WP_010922076.1 | phage minor capsid protein | - |
| DQL37_RS03170 (NCTC12052_00624) | - | 580699..580926 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| DQL37_RS03175 (NCTC12052_00625) | - | 581013..581279 (+) | 267 | WP_010922078.1 | hypothetical protein | - |
| DQL37_RS03180 (NCTC12052_00626) | - | 581405..582019 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| DQL37_RS03185 (NCTC12052_00627) | - | 582023..582841 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DQL37_RS03190 (NCTC12052_00628) | - | 582895..583311 (+) | 417 | WP_111685706.1 | hypothetical protein | - |
| DQL37_RS03195 (NCTC12052_00629) | - | 583301..583633 (+) | 333 | WP_111685707.1 | minor capsid protein | - |
| DQL37_RS03200 (NCTC12052_00630) | - | 583633..583989 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQL37_RS03205 (NCTC12052_00631) | - | 583986..584384 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQL37_RS03210 (NCTC12052_00632) | - | 584384..584869 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| DQL37_RS03215 (NCTC12052_00633) | - | 584908..585342 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| DQL37_RS03220 (NCTC12052_00634) | - | 585346..585927 (+) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| DQL37_RS03225 (NCTC12052_00635) | - | 585917..589177 (+) | 3261 | WP_030126579.1 | tape measure protein | - |
| DQL37_RS03230 (NCTC12052_00636) | - | 589174..589890 (+) | 717 | WP_111685708.1 | distal tail protein Dit | - |
| DQL37_RS03235 (NCTC12052_00637) | - | 589887..592031 (+) | 2145 | WP_021775334.1 | phage tail spike protein | - |
| DQL37_RS03240 (NCTC12052_00638) | - | 592028..593032 (+) | 1005 | WP_111685709.1 | hyaluronoglucosaminidase | - |
| DQL37_RS03245 (NCTC12052_00639) | - | 593047..594933 (+) | 1887 | WP_111685710.1 | gp58-like family protein | - |
| DQL37_RS03250 (NCTC12052_00640) | - | 594945..595376 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQL37_RS03255 (NCTC12052_00641) | - | 595379..595996 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| DQL37_RS03260 (NCTC12052_00642) | - | 596006..596281 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQL37_RS03265 (NCTC12052_00643) | - | 596278..596505 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQL37_RS03270 (NCTC12052_00644) | - | 596621..597823 (+) | 1203 | WP_111685711.1 | glucosaminidase domain-containing protein | - |
| DQL37_RS09860 | - | 597856..598038 (+) | 183 | Protein_589 | holin | - |
| DQL37_RS03280 (NCTC12052_00645) | - | 598190..598732 (+) | 543 | WP_032465096.1 | Panacea domain-containing protein | - |
| DQL37_RS03285 (NCTC12052_00646) | - | 598736..599572 (+) | 837 | WP_032465095.1 | hypothetical protein | - |
| DQL37_RS03290 (NCTC12052_00647) | - | 599640..599996 (-) | 357 | WP_003055891.1 | hypothetical protein | - |
| DQL37_RS03295 (NCTC12052_00648) | - | 599998..600471 (-) | 474 | WP_003055874.1 | hypothetical protein | - |
| DQL37_RS03300 (NCTC12052_00649) | - | 600510..600749 (-) | 240 | WP_003055856.1 | hypothetical protein | - |
| DQL37_RS03305 (NCTC12052_00650) | prx | 600952..601131 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
| DQL37_RS10010 | - | 601309..601584 (-) | 276 | Protein_596 | tyrosine-type recombinase/integrase | - |
| DQL37_RS09865 | - | 601589..601859 (+) | 271 | Protein_597 | rod shape-determining protein RodA | - |
| DQL37_RS03315 (NCTC12052_00653) | - | 601962..602522 (+) | 561 | WP_011017599.1 | HAD-IA family hydrolase | - |
| DQL37_RS03320 (NCTC12052_00654) | gyrB | 602523..604475 (+) | 1953 | WP_002994058.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=1138047 DQL37_RS03305 WP_030127450.1 600952..601131(+) (prx) [Streptococcus pyogenes strain NCTC12052]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=1138047 DQL37_RS03305 WP_030127450.1 600952..601131(+) (prx) [Streptococcus pyogenes strain NCTC12052]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |