Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM42_RS07635 | Genome accession | NZ_LS483351 |
| Coordinates | 1431817..1431996 (-) | Length | 59 a.a. |
| NCBI ID | WP_002983481.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8195 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1431817..1471788 | 1431817..1431996 | within | 0 |
Gene organization within MGE regions
Location: 1431817..1471788
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM42_RS07635 (NCTC8195_01531) | prx | 1431817..1431996 (-) | 180 | WP_002983481.1 | hypothetical protein | Regulator |
| DQM42_RS07640 (NCTC8195_01532) | - | 1432063..1432857 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| DQM42_RS07645 (NCTC8195_01533) | - | 1433102..1434316 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| DQM42_RS07650 (NCTC8195_01535) | - | 1434428..1434883 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| DQM42_RS07655 (NCTC8195_01536) | - | 1434894..1435526 (-) | 633 | WP_002983470.1 | hypothetical protein | - |
| DQM42_RS07660 (NCTC8195_01537) | - | 1435529..1435960 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| DQM42_RS07665 (NCTC8195_01538) | - | 1435972..1437990 (-) | 2019 | WP_111690677.1 | gp58-like family protein | - |
| DQM42_RS07670 (NCTC8195_01539) | - | 1438003..1439124 (-) | 1122 | WP_111680780.1 | hyaluronoglucosaminidase | - |
| DQM42_RS07675 (NCTC8195_01540) | - | 1439124..1441163 (-) | 2040 | WP_002983450.1 | phage tail protein | - |
| DQM42_RS07680 (NCTC8195_01541) | - | 1441173..1442015 (-) | 843 | WP_002983449.1 | phage tail family protein | - |
| DQM42_RS07685 (NCTC8195_01542) | - | 1442027..1446052 (-) | 4026 | Protein_1442 | tape measure protein | - |
| DQM42_RS07690 (NCTC8195_01543) | - | 1446067..1446300 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| DQM42_RS07695 (NCTC8195_01544) | - | 1446375..1446830 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DQM42_RS07700 (NCTC8195_01545) | - | 1446884..1447483 (-) | 600 | WP_002983441.1 | phage major tail protein, TP901-1 family | - |
| DQM42_RS07705 (NCTC8195_01546) | - | 1447495..1447854 (-) | 360 | WP_002983439.1 | hypothetical protein | - |
| DQM42_RS07710 (NCTC8195_01547) | - | 1447858..1448200 (-) | 343 | Protein_1447 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM42_RS07715 (NCTC8195_01548) | - | 1448197..1448475 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| DQM42_RS07720 (NCTC8195_01549) | - | 1448486..1448842 (-) | 357 | WP_002983431.1 | phage head-tail connector protein | - |
| DQM42_RS07725 (NCTC8195_01550) | - | 1448854..1449741 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| DQM42_RS07730 (NCTC8195_01551) | - | 1449754..1450323 (-) | 570 | WP_002983425.1 | DUF4355 domain-containing protein | - |
| DQM42_RS07735 (NCTC8195_01552) | - | 1450484..1450750 (-) | 267 | WP_002983424.1 | hypothetical protein | - |
| DQM42_RS07740 | - | 1450753..1450941 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| DQM42_RS07745 (NCTC8195_01554) | - | 1450972..1452417 (-) | 1446 | WP_002983422.1 | minor capsid protein | - |
| DQM42_RS07750 (NCTC8195_01555) | - | 1452377..1453909 (-) | 1533 | WP_002983421.1 | phage portal protein | - |
| DQM42_RS07755 (NCTC8195_01556) | - | 1453924..1455201 (-) | 1278 | WP_002983420.1 | PBSX family phage terminase large subunit | - |
| DQM42_RS07760 (NCTC8195_01557) | - | 1455191..1455643 (-) | 453 | WP_032467259.1 | terminase small subunit | - |
| DQM42_RS07765 (NCTC8195_01558) | - | 1455739..1456152 (-) | 414 | WP_002983418.1 | transcriptional regulator | - |
| DQM42_RS07770 (NCTC8195_01559) | - | 1456285..1456551 (-) | 267 | WP_032467258.1 | hypothetical protein | - |
| DQM42_RS10025 (NCTC8195_01560) | - | 1456554..1456715 (-) | 162 | WP_002983415.1 | hypothetical protein | - |
| DQM42_RS07775 (NCTC8195_01561) | - | 1456716..1458038 (-) | 1323 | WP_002983414.1 | SNF2-related protein | - |
| DQM42_RS07780 (NCTC8195_01562) | - | 1458035..1458310 (-) | 276 | WP_002983413.1 | VRR-NUC domain-containing protein | - |
| DQM42_RS07785 (NCTC8195_01563) | - | 1458677..1461061 (-) | 2385 | WP_002983412.1 | phage/plasmid primase, P4 family | - |
| DQM42_RS07790 (NCTC8195_01564) | - | 1461066..1462997 (-) | 1932 | WP_002983411.1 | DNA polymerase | - |
| DQM42_RS07795 (NCTC8195_01565) | - | 1463040..1463603 (-) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| DQM42_RS07800 (NCTC8195_01566) | - | 1463617..1464774 (-) | 1158 | WP_002983409.1 | DUF2800 domain-containing protein | - |
| DQM42_RS07805 (NCTC8195_01567) | - | 1464774..1465073 (-) | 300 | WP_002983408.1 | hypothetical protein | - |
| DQM42_RS07810 (NCTC8195_01568) | - | 1465161..1465364 (-) | 204 | WP_002983407.1 | hypothetical protein | - |
| DQM42_RS10030 (NCTC8195_01569) | - | 1465361..1465513 (-) | 153 | WP_002983406.1 | hypothetical protein | - |
| DQM42_RS07815 (NCTC8195_01570) | - | 1465510..1465893 (-) | 384 | WP_002983405.1 | hypothetical protein | - |
| DQM42_RS07820 (NCTC8195_01571) | - | 1465890..1466096 (-) | 207 | WP_002983404.1 | hypothetical protein | - |
| DQM42_RS07825 (NCTC8195_01572) | - | 1466089..1466259 (-) | 171 | WP_002983403.1 | hypothetical protein | - |
| DQM42_RS07830 (NCTC8195_01573) | - | 1466256..1466531 (-) | 276 | WP_032467257.1 | DNA-binding phage protein | - |
| DQM42_RS07835 (NCTC8195_01574) | - | 1466590..1466799 (-) | 210 | WP_002983400.1 | helix-turn-helix domain-containing protein | - |
| DQM42_RS07840 (NCTC8195_01575) | - | 1467091..1467438 (+) | 348 | WP_002983399.1 | helix-turn-helix domain-containing protein | - |
| DQM42_RS07845 (NCTC8195_01576) | - | 1467442..1467828 (+) | 387 | WP_002983397.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM42_RS07850 (NCTC8195_01577) | - | 1467953..1469674 (+) | 1722 | WP_002983395.1 | ATP-dependent nuclease | - |
| DQM42_RS07855 (NCTC8195_01578) | - | 1469731..1470588 (+) | 858 | WP_111680774.1 | DNA adenine methylase | - |
| DQM42_RS07860 (NCTC8195_01579) | - | 1470709..1471788 (+) | 1080 | WP_002983389.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.1813
>NTDB_id=1138005 DQM42_RS07635 WP_002983481.1 1431817..1431996(-) (prx) [Streptococcus pyogenes strain NCTC8195]
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=1138005 DQM42_RS07635 WP_002983481.1 1431817..1431996(-) (prx) [Streptococcus pyogenes strain NCTC8195]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |