Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM42_RS05715 | Genome accession | NZ_LS483351 |
| Coordinates | 1060502..1060690 (-) | Length | 62 a.a. |
| NCBI ID | WP_002984426.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8195 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1052914..1107093 | 1060502..1060690 | within | 0 |
Gene organization within MGE regions
Location: 1052914..1107093
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM42_RS05680 (NCTC8195_01142) | pfkA | 1052914..1053927 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| DQM42_RS05685 (NCTC8195_01143) | - | 1054007..1057117 (-) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| DQM42_RS05690 (NCTC8195_01144) | - | 1057302..1057673 (+) | 372 | WP_032467272.1 | GntR family transcriptional regulator | - |
| DQM42_RS05695 (NCTC8195_01145) | - | 1057673..1058371 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQM42_RS05700 (NCTC8195_01146) | - | 1058381..1059166 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| DQM42_RS05705 (NCTC8195_01147) | - | 1059297..1059911 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM42_RS05715 (NCTC8195_01149) | prx | 1060502..1060690 (-) | 189 | WP_002984426.1 | hypothetical protein | Regulator |
| DQM42_RS05720 (NCTC8195_01150) | sda3 | 1060928..1061728 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DQM42_RS05730 (NCTC8195_01152) | - | 1062504..1063709 (-) | 1206 | WP_002984418.1 | glucosaminidase domain-containing protein | - |
| DQM42_RS05735 (NCTC8195_01154) | - | 1063825..1064052 (-) | 228 | WP_003058873.1 | phage holin | - |
| DQM42_RS05740 (NCTC8195_01155) | - | 1064049..1064324 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQM42_RS05745 (NCTC8195_01156) | - | 1064334..1064951 (-) | 618 | WP_047235258.1 | DUF1366 domain-containing protein | - |
| DQM42_RS05750 (NCTC8195_01157) | - | 1064954..1065115 (-) | 162 | WP_002987333.1 | hypothetical protein | - |
| DQM42_RS05755 (NCTC8195_01158) | - | 1065129..1067039 (-) | 1911 | WP_002987337.1 | gp58-like family protein | - |
| DQM42_RS05760 (NCTC8195_01159) | - | 1067052..1068059 (-) | 1008 | WP_047235257.1 | hyaluronoglucosaminidase | - |
| DQM42_RS05765 (NCTC8195_01160) | - | 1068056..1070107 (-) | 2052 | WP_002984413.1 | phage tail spike protein | - |
| DQM42_RS05770 (NCTC8195_01161) | - | 1070104..1070883 (-) | 780 | WP_002984411.1 | distal tail protein Dit | - |
| DQM42_RS05775 (NCTC8195_01162) | - | 1070915..1074181 (-) | 3267 | WP_047235256.1 | tape measure protein | - |
| DQM42_RS05780 (NCTC8195_01163) | - | 1074196..1074525 (-) | 330 | WP_002984407.1 | hypothetical protein | - |
| DQM42_RS05785 (NCTC8195_01164) | - | 1074567..1074926 (-) | 360 | WP_002984405.1 | tail assembly chaperone | - |
| DQM42_RS05790 (NCTC8195_01165) | - | 1074979..1075581 (-) | 603 | WP_002984403.1 | phage major tail protein, TP901-1 family | - |
| DQM42_RS05795 (NCTC8195_01166) | - | 1075637..1076026 (-) | 390 | WP_002984401.1 | hypothetical protein | - |
| DQM42_RS05800 (NCTC8195_01167) | - | 1076023..1076388 (-) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM42_RS05805 (NCTC8195_01168) | - | 1076369..1076677 (-) | 309 | WP_002984393.1 | hypothetical protein | - |
| DQM42_RS05810 (NCTC8195_01169) | - | 1076674..1077027 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DQM42_RS05815 (NCTC8195_01170) | - | 1077041..1077283 (-) | 243 | WP_002984390.1 | HeH/LEM domain-containing protein | - |
| DQM42_RS05820 (NCTC8195_01171) | - | 1077293..1078369 (-) | 1077 | WP_002984388.1 | major capsid protein | - |
| DQM42_RS05825 (NCTC8195_01172) | - | 1078369..1078749 (-) | 381 | WP_002984386.1 | phage protein | - |
| DQM42_RS05830 (NCTC8195_01173) | - | 1078759..1079292 (-) | 534 | WP_002984384.1 | DUF4355 domain-containing protein | - |
| DQM42_RS05835 (NCTC8195_01174) | - | 1079404..1080147 (-) | 744 | WP_002984382.1 | phage repressor protein/antirepressor Ant | - |
| DQM42_RS05840 (NCTC8195_01175) | - | 1080149..1080397 (-) | 249 | WP_002984380.1 | hypothetical protein | - |
| DQM42_RS05845 (NCTC8195_01176) | - | 1080512..1080715 (-) | 204 | WP_002984377.1 | hypothetical protein | - |
| DQM42_RS05850 (NCTC8195_01177) | - | 1080787..1081056 (-) | 270 | WP_002984375.1 | hypothetical protein | - |
| DQM42_RS05855 (NCTC8195_01178) | - | 1081116..1081295 (-) | 180 | WP_010922213.1 | hypothetical protein | - |
| DQM42_RS05860 (NCTC8195_01179) | - | 1081286..1082911 (-) | 1626 | WP_002984371.1 | phage head morphogenesis protein | - |
| DQM42_RS05865 (NCTC8195_01180) | - | 1082892..1084394 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| DQM42_RS05870 (NCTC8195_01181) | - | 1084406..1085713 (-) | 1308 | WP_047235253.1 | PBSX family phage terminase large subunit | - |
| DQM42_RS05875 (NCTC8195_01182) | - | 1085691..1086122 (-) | 432 | WP_020833531.1 | terminase small subunit | - |
| DQM42_RS05880 (NCTC8195_01183) | - | 1086221..1086406 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DQM42_RS05885 (NCTC8195_01184) | - | 1086458..1086835 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DQM42_RS10005 | - | 1087131..1087364 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| DQM42_RS05895 (NCTC8195_01186) | - | 1087454..1088368 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| DQM42_RS05900 (NCTC8195_01188) | - | 1089290..1089727 (-) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| DQM42_RS05905 (NCTC8195_01189) | - | 1089996..1090631 (-) | 636 | WP_002987471.1 | N-6 DNA methylase | - |
| DQM42_RS05910 (NCTC8195_01190) | - | 1090631..1091032 (-) | 402 | WP_002987468.1 | hypothetical protein | - |
| DQM42_RS05915 (NCTC8195_01191) | - | 1091223..1091705 (-) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| DQM42_RS05920 (NCTC8195_01192) | - | 1091709..1091993 (-) | 285 | WP_011889038.1 | hypothetical protein | - |
| DQM42_RS10190 | - | 1091990..1092103 (-) | 114 | Protein_1114 | YopX family protein | - |
| DQM42_RS05930 (NCTC8195_01193) | - | 1092194..1092463 (-) | 270 | WP_047235252.1 | hypothetical protein | - |
| DQM42_RS05935 (NCTC8195_01194) | - | 1092460..1092744 (-) | 285 | WP_020905119.1 | DUF3310 domain-containing protein | - |
| DQM42_RS10335 (NCTC8195_01195) | - | 1092738..1092974 (-) | 237 | WP_047235251.1 | hypothetical protein | - |
| DQM42_RS05945 (NCTC8195_01196) | - | 1092971..1093327 (-) | 357 | WP_002984340.1 | hypothetical protein | - |
| DQM42_RS05950 (NCTC8195_01197) | - | 1093311..1093595 (-) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| DQM42_RS05955 (NCTC8195_01198) | - | 1093615..1094484 (-) | 870 | WP_002984334.1 | bifunctional DNA primase/polymerase | - |
| DQM42_RS05960 (NCTC8195_01199) | - | 1094751..1096304 (-) | 1554 | WP_002984332.1 | hypothetical protein | - |
| DQM42_RS05965 (NCTC8195_01200) | - | 1096322..1096804 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DQM42_RS05970 (NCTC8195_01201) | - | 1096809..1098242 (-) | 1434 | Protein_1123 | DEAD/DEAH box helicase | - |
| DQM42_RS05975 (NCTC8195_01202) | - | 1098248..1098931 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DQM42_RS05980 (NCTC8195_01203) | - | 1098928..1099212 (-) | 285 | WP_002984318.1 | hypothetical protein | - |
| DQM42_RS05985 (NCTC8195_01204) | - | 1099209..1099403 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQM42_RS05990 (NCTC8195_01205) | - | 1099403..1099732 (-) | 330 | WP_002984312.1 | hypothetical protein | - |
| DQM42_RS05995 (NCTC8195_01207) | - | 1099813..1099950 (-) | 138 | WP_002984309.1 | hypothetical protein | - |
| DQM42_RS06000 (NCTC8195_01208) | - | 1099947..1100243 (-) | 297 | WP_002984306.1 | MerR family transcriptional regulator | - |
| DQM42_RS06005 (NCTC8195_01209) | - | 1100321..1100506 (-) | 186 | WP_002984304.1 | helix-turn-helix domain-containing protein | - |
| DQM42_RS06010 (NCTC8195_01210) | - | 1100650..1100868 (+) | 219 | WP_032467270.1 | hypothetical protein | - |
| DQM42_RS10285 (NCTC8195_01211) | - | 1100854..1100985 (-) | 132 | WP_002984298.1 | hypothetical protein | - |
| DQM42_RS06015 (NCTC8195_01212) | - | 1101041..1101250 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQM42_RS06025 (NCTC8195_01214) | - | 1101509..1102018 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| DQM42_RS06030 (NCTC8195_01215) | - | 1102126..1102353 (-) | 228 | WP_002984281.1 | hypothetical protein | - |
| DQM42_RS06035 (NCTC8195_01216) | - | 1102427..1102909 (+) | 483 | WP_023605145.1 | hypothetical protein | - |
| DQM42_RS10010 (NCTC8195_01217) | - | 1102906..1103052 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| DQM42_RS06040 (NCTC8195_01218) | - | 1103213..1103950 (+) | 738 | WP_002984272.1 | XRE family transcriptional regulator | - |
| DQM42_RS06045 (NCTC8195_01219) | - | 1103963..1104772 (+) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM42_RS06050 (NCTC8195_01220) | - | 1105022..1106110 (+) | 1089 | WP_002984265.1 | site-specific integrase | - |
| DQM42_RS06055 (NCTC8195_01221) | - | 1106473..1107093 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7253.32 Da Isoelectric Point: 4.2550
>NTDB_id=1137996 DQM42_RS05715 WP_002984426.1 1060502..1060690(-) (prx) [Streptococcus pyogenes strain NCTC8195]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDYIK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1137996 DQM42_RS05715 WP_002984426.1 1060502..1060690(-) (prx) [Streptococcus pyogenes strain NCTC8195]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90.323 |
100 |
0.903 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
83.051 |
95.161 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
95.161 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
67.742 |
0.532 |