Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM50_RS04985 | Genome accession | NZ_LS483347 |
| Coordinates | 916902..917090 (+) | Length | 62 a.a. |
| NCBI ID | WP_032461628.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8324 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 871841..919921 | 916902..917090 | within | 0 |
Gene organization within MGE regions
Location: 871841..919921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM50_RS04640 (NCTC8324_00940) | - | 871841..872461 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQM50_RS04645 (NCTC8324_00941) | - | 872823..873911 (-) | 1089 | WP_011017891.1 | site-specific integrase | - |
| DQM50_RS04650 (NCTC8324_00942) | - | 874160..874969 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM50_RS04655 (NCTC8324_00943) | - | 874982..875725 (-) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| DQM50_RS09960 (NCTC8324_00944) | - | 876084..876233 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DQM50_RS04660 (NCTC8324_00945) | - | 876219..876434 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DQM50_RS04665 (NCTC8324_00946) | - | 876493..876651 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DQM50_RS04670 (NCTC8324_00947) | - | 876681..877280 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQM50_RS04675 (NCTC8324_00948) | - | 877334..877543 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DQM50_RS04680 (NCTC8324_00949) | - | 877532..877918 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DQM50_RS04685 (NCTC8324_00950) | - | 877992..878219 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DQM50_RS04690 (NCTC8324_00951) | - | 878327..878836 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DQM50_RS04700 (NCTC8324_00953) | - | 879095..879304 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQM50_RS04705 (NCTC8324_00954) | - | 879454..879693 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQM50_RS04710 (NCTC8324_00955) | - | 879860..880045 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS04715 (NCTC8324_00956) | - | 880124..880420 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQM50_RS04720 (NCTC8324_00957) | - | 880417..880554 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| DQM50_RS04725 (NCTC8324_00959) | - | 880635..880964 (+) | 330 | WP_002984312.1 | hypothetical protein | - |
| DQM50_RS04730 (NCTC8324_00960) | - | 880964..881158 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQM50_RS04735 (NCTC8324_00961) | - | 881155..881439 (+) | 285 | WP_002984318.1 | hypothetical protein | - |
| DQM50_RS04740 (NCTC8324_00962) | - | 881436..882119 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DQM50_RS04745 (NCTC8324_00963) | - | 882125..883558 (+) | 1434 | Protein_864 | DEAD/DEAH box helicase | - |
| DQM50_RS04750 (NCTC8324_00964) | - | 883563..884045 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DQM50_RS04755 (NCTC8324_00965) | - | 884063..885616 (+) | 1554 | WP_111688459.1 | phage resistance protein | - |
| DQM50_RS04760 (NCTC8324_00966) | - | 885883..886752 (+) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| DQM50_RS04765 (NCTC8324_00967) | - | 886772..887056 (+) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| DQM50_RS04770 (NCTC8324_00968) | - | 887040..887396 (+) | 357 | WP_111688460.1 | hypothetical protein | - |
| DQM50_RS10275 (NCTC8324_00969) | - | 887393..887624 (+) | 232 | Protein_870 | hypothetical protein | - |
| DQM50_RS04780 (NCTC8324_00970) | - | 887621..887896 (+) | 276 | WP_020833538.1 | nucleotide modification associated domain-containing protein | - |
| DQM50_RS04785 (NCTC8324_00971) | - | 887893..888162 (+) | 270 | WP_020833537.1 | hypothetical protein | - |
| DQM50_RS04790 (NCTC8324_00972) | - | 888172..888552 (+) | 381 | WP_020833536.1 | YopX family protein | - |
| DQM50_RS04795 (NCTC8324_00973) | - | 888549..888833 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| DQM50_RS04800 (NCTC8324_00974) | - | 888835..889470 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| DQM50_RS04810 (NCTC8324_00975) | - | 889744..890178 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM50_RS04820 (NCTC8324_00976) | - | 890756..891670 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DQM50_RS09965 | - | 891760..891993 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DQM50_RS04830 (NCTC8324_00978) | - | 892288..892665 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DQM50_RS04835 (NCTC8324_00979) | - | 892717..892902 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DQM50_RS04840 (NCTC8324_00980) | - | 893001..893432 (+) | 432 | WP_020833531.1 | terminase small subunit | - |
| DQM50_RS04845 (NCTC8324_00981) | - | 893410..894717 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DQM50_RS04850 (NCTC8324_00982) | - | 894729..896231 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DQM50_RS10340 (NCTC8324_00983) | - | 896212..897225 (+) | 1014 | WP_111688462.1 | minor capsid protein | - |
| DQM50_RS10345 (NCTC8324_00984) | - | 897170..897775 (+) | 606 | WP_011184918.1 | ADP-ribosyltransferase | - |
| DQM50_RS04865 (NCTC8324_00985) | - | 897779..897964 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DQM50_RS04875 (NCTC8324_00986) | - | 898350..898616 (+) | 267 | WP_111688463.1 | hypothetical protein | - |
| DQM50_RS04880 (NCTC8324_00987) | - | 898760..899293 (+) | 534 | WP_002992590.1 | DUF4355 domain-containing protein | - |
| DQM50_RS04885 (NCTC8324_00988) | - | 899303..899683 (+) | 381 | WP_111688464.1 | head decoration protein | - |
| DQM50_RS04890 (NCTC8324_00989) | - | 899686..900768 (+) | 1083 | WP_111688465.1 | major capsid protein | - |
| DQM50_RS04895 (NCTC8324_00990) | - | 900778..901020 (+) | 243 | WP_111688466.1 | HeH/LEM domain-containing protein | - |
| DQM50_RS04900 (NCTC8324_00991) | - | 901034..901387 (+) | 354 | WP_111688467.1 | phage head-tail connector protein | - |
| DQM50_RS04905 (NCTC8324_00992) | - | 901384..901692 (+) | 309 | WP_002984393.1 | hypothetical protein | - |
| DQM50_RS04910 (NCTC8324_00993) | - | 901673..902038 (+) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM50_RS04915 (NCTC8324_00994) | - | 902035..902424 (+) | 390 | WP_020833525.1 | hypothetical protein | - |
| DQM50_RS04920 (NCTC8324_00995) | - | 902521..903123 (+) | 603 | WP_111688603.1 | phage major tail protein, TP901-1 family | - |
| DQM50_RS04925 (NCTC8324_00996) | - | 903177..903530 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DQM50_RS04930 (NCTC8324_00997) | - | 903572..903901 (+) | 330 | WP_002988428.1 | hypothetical protein | - |
| DQM50_RS04935 (NCTC8324_00998) | - | 903916..907551 (+) | 3636 | WP_111688468.1 | tape measure protein | - |
| DQM50_RS04940 (NCTC8324_00999) | - | 907584..908363 (+) | 780 | WP_011184914.1 | distal tail protein Dit | - |
| DQM50_RS04945 (NCTC8324_01000) | - | 908360..910411 (+) | 2052 | WP_111688469.1 | phage tail spike protein | - |
| DQM50_RS04950 (NCTC8324_01001) | hylP | 910408..911421 (+) | 1014 | WP_010922091.1 | hyaluronidase HylP | - |
| DQM50_RS04955 (NCTC8324_01002) | - | 911436..913319 (+) | 1884 | WP_111688470.1 | gp58-like family protein | - |
| DQM50_RS04960 (NCTC8324_01003) | - | 913331..913762 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DQM50_RS04965 (NCTC8324_01004) | - | 913765..914382 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| DQM50_RS04970 (NCTC8324_01005) | - | 914392..914664 (+) | 273 | WP_111688471.1 | hypothetical protein | - |
| DQM50_RS04975 (NCTC8324_01006) | - | 914661..914888 (+) | 228 | WP_003058873.1 | phage holin | - |
| DQM50_RS04980 (NCTC8324_01008) | - | 915004..916206 (+) | 1203 | WP_111688472.1 | glucosaminidase domain-containing protein | - |
| DQM50_RS04985 (NCTC8324_01010) | prx | 916902..917090 (+) | 189 | WP_032461628.1 | hypothetical protein | Regulator |
| DQM50_RS04995 (NCTC8324_01012) | - | 917681..918295 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM50_RS05000 (NCTC8324_01013) | - | 918428..919213 (-) | 786 | WP_023078569.1 | hypothetical protein | - |
| DQM50_RS05005 (NCTC8324_01014) | - | 919223..919921 (-) | 699 | WP_023078568.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7312.35 Da Isoelectric Point: 4.1813
>NTDB_id=1137769 DQM50_RS04985 WP_032461628.1 916902..917090(+) (prx) [Streptococcus pyogenes strain NCTC8324]
MLTYDEFKQAIDNGYITADTVMIVRKNEQIFDYVLPHEKVKNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDNGYITADTVMIVRKNEQIFDYVLPHEKVKNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1137769 DQM50_RS04985 WP_032461628.1 916902..917090(+) (prx) [Streptococcus pyogenes strain NCTC8324]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGAACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACCGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGAACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACCGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
88.71 |
100 |
0.887 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
93.548 |
0.823 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
95.161 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
67.742 |
0.5 |