Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM50_RS04140 | Genome accession | NZ_LS483347 |
| Coordinates | 763591..763773 (+) | Length | 60 a.a. |
| NCBI ID | WP_063632461.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8324 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 717402..763773 | 763591..763773 | within | 0 |
Gene organization within MGE regions
Location: 717402..763773
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM50_RS03835 (NCTC8324_00771) | - | 717420..718262 (+) | 843 | WP_168393021.1 | SGNH/GDSL hydrolase family protein | - |
| DQM50_RS03840 (NCTC8324_00772) | - | 718240..718827 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQM50_RS03845 (NCTC8324_00773) | - | 718926..719201 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQM50_RS03850 (NCTC8324_00774) | - | 719291..720433 (-) | 1143 | WP_111688443.1 | tyrosine-type recombinase/integrase | - |
| DQM50_RS03855 (NCTC8324_00775) | - | 720557..720823 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| DQM50_RS03860 (NCTC8324_00776) | - | 720835..721215 (-) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM50_RS03865 (NCTC8324_00777) | - | 721219..721566 (-) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS03870 | - | 721989..722084 (-) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQM50_RS03875 (NCTC8324_00779) | - | 722720..722911 (+) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQM50_RS03880 (NCTC8324_00780) | - | 722923..723639 (+) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM50_RS03885 (NCTC8324_00781) | - | 723671..723937 (+) | 267 | WP_010922204.1 | hypothetical protein | - |
| DQM50_RS03890 (NCTC8324_00782) | - | 723872..724678 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQM50_RS03895 (NCTC8324_00783) | - | 724820..725059 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQM50_RS03900 (NCTC8324_00784) | - | 725226..725411 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS03905 (NCTC8324_00785) | - | 725488..725745 (+) | 258 | WP_047149513.1 | hypothetical protein | - |
| DQM50_RS03910 (NCTC8324_00786) | - | 725774..725944 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQM50_RS03915 (NCTC8324_00787) | - | 725937..726140 (+) | 204 | WP_047149512.1 | hypothetical protein | - |
| DQM50_RS03920 (NCTC8324_00788) | - | 726137..726523 (+) | 387 | WP_047149511.1 | hypothetical protein | - |
| DQM50_RS03925 (NCTC8324_00790) | - | 726669..726872 (+) | 204 | WP_030127426.1 | hypothetical protein | - |
| DQM50_RS03930 (NCTC8324_00791) | - | 726960..727259 (+) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQM50_RS03935 (NCTC8324_00792) | - | 727259..728416 (+) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQM50_RS03940 (NCTC8324_00793) | - | 728425..728988 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQM50_RS03945 (NCTC8324_00794) | - | 729031..730953 (+) | 1923 | WP_111688400.1 | DNA polymerase | - |
| DQM50_RS03950 (NCTC8324_00795) | - | 730958..733342 (+) | 2385 | WP_111688444.1 | phage/plasmid primase, P4 family | - |
| DQM50_RS03955 (NCTC8324_00796) | - | 733728..734003 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQM50_RS03960 (NCTC8324_00797) | - | 734000..735322 (+) | 1323 | WP_111688445.1 | SNF2-related protein | - |
| DQM50_RS09955 (NCTC8324_00798) | - | 735323..735493 (+) | 171 | WP_164972002.1 | hypothetical protein | - |
| DQM50_RS03965 (NCTC8324_00799) | - | 735486..735758 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQM50_RS03970 (NCTC8324_00801) | - | 735891..736307 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQM50_RS03975 (NCTC8324_00802) | - | 736398..736850 (+) | 453 | WP_111688446.1 | terminase small subunit | - |
| DQM50_RS03980 (NCTC8324_00803) | - | 736828..738135 (+) | 1308 | WP_111688447.1 | PBSX family phage terminase large subunit | - |
| DQM50_RS03985 (NCTC8324_00804) | - | 738147..739649 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DQM50_RS03990 (NCTC8324_00805) | - | 739630..741192 (+) | 1563 | WP_002988386.1 | phage head morphogenesis protein | - |
| DQM50_RS03995 (NCTC8324_00806) | - | 741196..741381 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DQM50_RS04000 (NCTC8324_00807) | - | 741451..741765 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DQM50_RS04005 (NCTC8324_00808) | - | 741768..742034 (+) | 267 | WP_032462876.1 | hypothetical protein | - |
| DQM50_RS04010 (NCTC8324_00809) | - | 742178..742711 (+) | 534 | WP_014635511.1 | DUF4355 domain-containing protein | - |
| DQM50_RS04015 (NCTC8324_00810) | - | 742721..743101 (+) | 381 | WP_063632936.1 | hypothetical protein | - |
| DQM50_RS04020 (NCTC8324_00811) | - | 743104..744186 (+) | 1083 | WP_023078263.1 | major capsid protein | - |
| DQM50_RS04025 (NCTC8324_00812) | - | 744196..744438 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DQM50_RS04030 (NCTC8324_00813) | - | 744452..744805 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DQM50_RS04035 (NCTC8324_00814) | - | 744802..745110 (+) | 309 | WP_002984393.1 | hypothetical protein | - |
| DQM50_RS04040 (NCTC8324_00815) | - | 745091..745456 (+) | 366 | WP_038432514.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM50_RS04045 (NCTC8324_00816) | - | 745453..745842 (+) | 390 | WP_014635506.1 | hypothetical protein | - |
| DQM50_RS04050 (NCTC8324_00817) | - | 745897..746502 (+) | 606 | WP_080465176.1 | phage major tail protein, TP901-1 family | - |
| DQM50_RS04055 (NCTC8324_00818) | - | 746555..746914 (+) | 360 | WP_023605140.1 | tail assembly chaperone | - |
| DQM50_RS04060 (NCTC8324_00819) | - | 746956..747285 (+) | 330 | WP_111681178.1 | hypothetical protein | - |
| DQM50_RS04065 (NCTC8324_00820) | - | 747300..750935 (+) | 3636 | WP_111688448.1 | tape measure protein | - |
| DQM50_RS04070 (NCTC8324_00821) | - | 750967..751746 (+) | 780 | WP_032461961.1 | distal tail protein Dit | - |
| DQM50_RS04075 (NCTC8324_00822) | - | 751743..753791 (+) | 2049 | WP_111688449.1 | phage tail spike protein | - |
| DQM50_RS04080 (NCTC8324_00823) | hylP | 753791..754804 (+) | 1014 | WP_111688450.1 | hyaluronidase HylP | - |
| DQM50_RS04085 (NCTC8324_00824) | - | 754819..756705 (+) | 1887 | WP_111688451.1 | gp58-like family protein | - |
| DQM50_RS04090 (NCTC8324_00825) | - | 756717..757145 (+) | 429 | WP_111688452.1 | DUF1617 family protein | - |
| DQM50_RS04095 (NCTC8324_00826) | - | 757148..757780 (+) | 633 | WP_023611372.1 | hypothetical protein | - |
| DQM50_RS04100 (NCTC8324_00827) | - | 757791..758087 (+) | 297 | WP_023078532.1 | hypothetical protein | - |
| DQM50_RS04105 (NCTC8324_00828) | - | 758084..758269 (+) | 186 | WP_011054731.1 | holin | - |
| DQM50_RS04110 (NCTC8324_00830) | - | 758380..758934 (+) | 555 | Protein_743 | glycoside hydrolase family 73 protein | - |
| DQM50_RS04115 (NCTC8324_00832) | - | 759301..759861 (+) | 561 | WP_227942967.1 | AP2 domain-containing protein | - |
| DQM50_RS04120 (NCTC8324_00833) | - | 759974..760615 (+) | 642 | Protein_745 | CHAP domain-containing protein | - |
| DQM50_RS04125 (NCTC8324_00835) | spem | 761481..762194 (+) | 714 | WP_011017838.1 | streptococcal pyrogenic exotoxin SpeM | - |
| DQM50_RS04130 (NCTC8324_00836) | - | 762670..763245 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQM50_RS04140 (NCTC8324_00838) | prx | 763591..763773 (+) | 183 | WP_063632461.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7081.04 Da Isoelectric Point: 4.1079
>NTDB_id=1137766 DQM50_RS04140 WP_063632461.1 763591..763773(+) (prx) [Streptococcus pyogenes strain NCTC8324]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1137766 DQM50_RS04140 WP_063632461.1 763591..763773(+) (prx) [Streptococcus pyogenes strain NCTC8324]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
70 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |