Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM50_RS03370 | Genome accession | NZ_LS483347 |
| Coordinates | 614817..614999 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain NCTC8324 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 577310..614999 | 614817..614999 | within | 0 |
Gene organization within MGE regions
Location: 577310..614999
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM50_RS03095 (NCTC8324_00619) | - | 577310..578476 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| DQM50_RS03100 (NCTC8324_00620) | - | 578654..580075 (-) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| DQM50_RS03105 (NCTC8324_00621) | - | 580090..580476 (-) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM50_RS03110 (NCTC8324_00622) | - | 580460..580801 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS03115 (NCTC8324_00623) | - | 580999..581211 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| DQM50_RS03120 (NCTC8324_00624) | - | 581239..581958 (+) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| DQM50_RS09945 (NCTC8324_00625) | - | 581962..582129 (+) | 168 | WP_021340232.1 | hypothetical protein | - |
| DQM50_RS03130 (NCTC8324_00627) | - | 582368..582619 (+) | 252 | WP_021340237.1 | helix-turn-helix transcriptional regulator | - |
| DQM50_RS10220 (NCTC8324_00628) | - | 582650..582784 (+) | 135 | WP_021340229.1 | hypothetical protein | - |
| DQM50_RS03135 (NCTC8324_00629) | - | 582800..583114 (+) | 315 | WP_111688423.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS03140 (NCTC8324_00630) | - | 583128..583958 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQM50_RS03145 (NCTC8324_00631) | - | 583945..584727 (+) | 783 | WP_111688424.1 | ATP-binding protein | - |
| DQM50_RS09950 (NCTC8324_00632) | - | 584718..584855 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| DQM50_RS03150 (NCTC8324_00633) | - | 584868..585221 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DQM50_RS03155 (NCTC8324_00634) | - | 585202..585456 (+) | 255 | WP_021341161.1 | hypothetical protein | - |
| DQM50_RS03160 (NCTC8324_00635) | - | 585478..585960 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| DQM50_RS03165 (NCTC8324_00636) | - | 585961..586635 (+) | 675 | WP_111688425.1 | ERF family protein | - |
| DQM50_RS03170 (NCTC8324_00637) | ssbA | 586628..587047 (+) | 420 | WP_011018140.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM50_RS03175 | - | 587053..587256 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQM50_RS03180 (NCTC8324_00638) | - | 587256..587696 (+) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQM50_RS03185 (NCTC8324_00639) | - | 587693..588049 (+) | 357 | WP_111688426.1 | hypothetical protein | - |
| DQM50_RS10265 (NCTC8324_00640) | - | 588046..588280 (+) | 235 | Protein_558 | hypothetical protein | - |
| DQM50_RS03195 (NCTC8324_00641) | - | 588274..588558 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| DQM50_RS03200 (NCTC8324_00642) | - | 588555..588968 (+) | 414 | WP_111688427.1 | YopX family protein | - |
| DQM50_RS03205 (NCTC8324_00643) | - | 588965..589249 (+) | 285 | WP_011017570.1 | hypothetical protein | - |
| DQM50_RS03210 (NCTC8324_00644) | - | 589253..589735 (+) | 483 | WP_111688428.1 | class I SAM-dependent methyltransferase | - |
| DQM50_RS03215 (NCTC8324_00645) | - | 589725..590489 (+) | 765 | WP_172451638.1 | DNA-methyltransferase | - |
| DQM50_RS03220 (NCTC8324_00646) | - | 590537..590830 (+) | 294 | WP_032460172.1 | hypothetical protein | - |
| DQM50_RS03225 (NCTC8324_00648) | - | 591195..591632 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| DQM50_RS03230 (NCTC8324_00649) | - | 592107..592487 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQM50_RS03235 (NCTC8324_00650) | - | 592477..593751 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DQM50_RS03240 (NCTC8324_00651) | - | 593751..595076 (+) | 1326 | WP_009880265.1 | phage portal protein | - |
| DQM50_RS03245 (NCTC8324_00652) | - | 595045..595953 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| DQM50_RS03250 (NCTC8324_00653) | - | 595960..596226 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| DQM50_RS03255 (NCTC8324_00654) | - | 596376..596948 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| DQM50_RS03260 (NCTC8324_00655) | - | 596966..597856 (+) | 891 | WP_111688430.1 | phage capsid protein | - |
| DQM50_RS03265 (NCTC8324_00656) | - | 597869..598162 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DQM50_RS03270 (NCTC8324_00657) | - | 598176..598520 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| DQM50_RS03275 (NCTC8324_00658) | - | 598517..598828 (+) | 312 | WP_111688431.1 | hypothetical protein | - |
| DQM50_RS03280 (NCTC8324_00659) | - | 598825..599220 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| DQM50_RS03285 (NCTC8324_00660) | - | 599222..599632 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DQM50_RS03290 (NCTC8324_00661) | - | 599644..600150 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| DQM50_RS03295 (NCTC8324_00662) | - | 600163..600480 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| DQM50_RS03300 (NCTC8324_00663) | - | 600453..600911 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| DQM50_RS03305 (NCTC8324_00664) | - | 600904..602709 (+) | 1806 | WP_011054802.1 | tail protein | - |
| DQM50_RS03310 (NCTC8324_00665) | - | 602710..604194 (+) | 1485 | WP_111688432.1 | distal tail protein Dit | - |
| DQM50_RS03315 (NCTC8324_00666) | - | 604195..607635 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| DQM50_RS03320 (NCTC8324_00667) | - | 607640..609502 (+) | 1863 | WP_111688433.1 | DUF859 family phage minor structural protein | - |
| DQM50_RS03325 (NCTC8324_00668) | - | 609513..609860 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQM50_RS10225 (NCTC8324_00669) | - | 609874..609996 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQM50_RS03330 (NCTC8324_00670) | - | 610010..610333 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQM50_RS03335 (NCTC8324_00671) | - | 610333..610665 (+) | 333 | WP_011054798.1 | phage holin | - |
| DQM50_RS03340 (NCTC8324_00672) | - | 610667..611431 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQM50_RS03345 (NCTC8324_00673) | - | 611443..612045 (+) | 603 | WP_111688434.1 | hypothetical protein | - |
| DQM50_RS03350 (NCTC8324_00674) | - | 612056..612829 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| DQM50_RS03355 (NCTC8324_00675) | - | 612839..613060 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQM50_RS03360 (NCTC8324_00676) | - | 613060..613719 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| DQM50_RS03365 (NCTC8324_00677) | speA | 613841..614596 (-) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQM50_RS03370 (NCTC8324_00678) | prx | 614817..614999 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=1137763 DQM50_RS03370 WP_011054793.1 614817..614999(+) (prx) [Streptococcus pyogenes strain NCTC8324]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1137763 DQM50_RS03370 WP_011054793.1 614817..614999(+) (prx) [Streptococcus pyogenes strain NCTC8324]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |