Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL04_RS03560 | Genome accession | NZ_LS483340 |
| Coordinates | 669921..670103 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12062 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 633775..670103 | 669921..670103 | within | 0 |
Gene organization within MGE regions
Location: 633775..670103
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL04_RS03290 (NCTC12062_00646) | - | 633793..634635 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| DQL04_RS03295 (NCTC12062_00647) | - | 634613..635200 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQL04_RS03300 (NCTC12062_00648) | - | 635299..635574 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL04_RS03305 (NCTC12062_00649) | - | 635663..636805 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL04_RS03310 (NCTC12062_00650) | - | 636929..637447 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQL04_RS03315 (NCTC12062_00651) | - | 637459..638214 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQL04_RS03320 (NCTC12062_00652) | - | 638416..638628 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQL04_RS03325 (NCTC12062_00654) | - | 638898..639209 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQL04_RS03330 (NCTC12062_00655) | - | 639211..639396 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQL04_RS09450 | - | 639490..639759 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQL04_RS03340 (NCTC12062_00656) | - | 639900..640286 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQL04_RS03345 (NCTC12062_00657) | - | 640267..640500 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQL04_RS03350 (NCTC12062_00658) | - | 640497..640637 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQL04_RS03355 (NCTC12062_00659) | - | 640646..640852 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQL04_RS03360 | - | 640908..641238 (+) | 331 | Protein_581 | hypothetical protein | - |
| DQL04_RS03365 (NCTC12062_00661) | - | 641241..642167 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQL04_RS03370 (NCTC12062_00662) | - | 642164..642364 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQL04_RS03375 (NCTC12062_00663) | - | 642357..643154 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQL04_RS03380 (NCTC12062_00665) | - | 643519..643914 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQL04_RS03385 (NCTC12062_00666) | - | 643911..645257 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DQL04_RS03390 (NCTC12062_00667) | - | 645268..645600 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQL04_RS03395 (NCTC12062_00668) | - | 645597..646109 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQL04_RS03400 (NCTC12062_00669) | - | 646145..646462 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQL04_RS09320 (NCTC12062_00670) | - | 646459..646614 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQL04_RS03405 (NCTC12062_00671) | - | 646611..646862 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQL04_RS03410 (NCTC12062_00672) | - | 646938..647357 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| DQL04_RS03415 | - | 647465..647809 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQL04_RS03420 (NCTC12062_00673) | - | 647957..648313 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQL04_RS03425 (NCTC12062_00674) | - | 648310..649578 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| DQL04_RS03430 (NCTC12062_00675) | - | 649571..651064 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQL04_RS03435 (NCTC12062_00676) | - | 651070..651294 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQL04_RS09325 (NCTC12062_00677) | - | 651371..651523 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| DQL04_RS03440 (NCTC12062_00678) | - | 651516..651782 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQL04_RS03445 (NCTC12062_00679) | - | 651784..651999 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| DQL04_RS03450 (NCTC12062_00680) | - | 652081..653496 (+) | 1416 | WP_011054685.1 | terminase | - |
| DQL04_RS03455 (NCTC12062_00681) | - | 653577..654038 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQL04_RS03460 (NCTC12062_00682) | - | 654063..654974 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| DQL04_RS03465 (NCTC12062_00683) | - | 654974..655174 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQL04_RS03470 (NCTC12062_00684) | - | 655184..655606 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL04_RS03475 (NCTC12062_00685) | - | 655566..655904 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQL04_RS03480 (NCTC12062_00686) | - | 655897..656133 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQL04_RS03485 (NCTC12062_00687) | - | 656134..656469 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQL04_RS03490 (NCTC12062_00688) | - | 656485..657075 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| DQL04_RS03495 (NCTC12062_00689) | - | 657086..657349 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQL04_RS03500 (NCTC12062_00690) | - | 657364..657735 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| DQL04_RS03505 (NCTC12062_00691) | - | 657735..660098 (+) | 2364 | WP_030126402.1 | hypothetical protein | - |
| DQL04_RS03510 (NCTC12062_00692) | - | 660095..660790 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQL04_RS03515 (NCTC12062_00693) | - | 660772..662745 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| DQL04_RS03520 (NCTC12062_00694) | - | 662745..663854 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| DQL04_RS03525 (NCTC12062_00695) | - | 663869..665650 (+) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| DQL04_RS03530 (NCTC12062_00696) | - | 665659..666087 (+) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| DQL04_RS03535 (NCTC12062_00697) | - | 666090..666701 (+) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| DQL04_RS03540 (NCTC12062_00698) | - | 666711..667166 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| DQL04_RS03545 (NCTC12062_00700) | - | 667284..668036 (+) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| DQL04_RS03550 (NCTC12062_00701) | speC | 668105..668812 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL04_RS03555 (NCTC12062_00702) | mf2 | 668923..669681 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQL04_RS03560 (NCTC12062_00703) | prx | 669921..670103 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=1137423 DQL04_RS03560 WP_011184726.1 669921..670103(+) (prx) [Streptococcus pyogenes strain NCTC12062]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1137423 DQL04_RS03560 WP_011184726.1 669921..670103(+) (prx) [Streptococcus pyogenes strain NCTC12062]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |