Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL34_RS00365 | Genome accession | NZ_LS483339 |
| Coordinates | 61041..61229 (+) | Length | 62 a.a. |
| NCBI ID | WP_111679075.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain NCTC12958 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 53604..62299 | 61041..61229 | within | 0 |
Gene organization within MGE regions
Location: 53604..62299
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL34_RS00305 (NCTC12958_00065) | - | 53604..54770 (-) | 1167 | WP_111679066.1 | tyrosine-type recombinase/integrase | - |
| DQL34_RS11700 (NCTC12958_00066) | - | 54912..55493 (-) | 582 | WP_084828737.1 | helix-turn-helix domain-containing protein | - |
| DQL34_RS00315 (NCTC12958_00067) | - | 55643..55813 (+) | 171 | WP_084829211.1 | helix-turn-helix transcriptional regulator | - |
| DQL34_RS00320 (NCTC12958_00068) | - | 56066..56359 (+) | 294 | WP_111679067.1 | hypothetical protein | - |
| DQL34_RS00325 (NCTC12958_00069) | - | 56363..56557 (+) | 195 | WP_024704077.1 | hypothetical protein | - |
| DQL34_RS00330 (NCTC12958_00070) | - | 56571..56807 (+) | 237 | WP_024704076.1 | hypothetical protein | - |
| DQL34_RS00340 (NCTC12958_00072) | - | 57143..57415 (+) | 273 | WP_023909303.1 | MerR family transcriptional regulator | - |
| DQL34_RS00345 (NCTC12958_00073) | - | 57430..58290 (+) | 861 | WP_111679069.1 | primase alpha helix C-terminal domain-containing protein | - |
| DQL34_RS00350 (NCTC12958_00074) | - | 58280..59785 (+) | 1506 | WP_111679071.1 | phage/plasmid primase, P4 family | - |
| DQL34_RS00355 (NCTC12958_00076) | - | 60082..60267 (+) | 186 | WP_111679073.1 | hypothetical protein | - |
| DQL34_RS00360 (NCTC12958_00077) | - | 60333..60560 (+) | 228 | WP_223899748.1 | hypothetical protein | - |
| DQL34_RS00365 (NCTC12958_00078) | prx | 61041..61229 (+) | 189 | WP_111679075.1 | hypothetical protein | Regulator |
| DQL34_RS00370 (NCTC12958_00079) | - | 61610..62299 (+) | 690 | WP_197709066.1 | DUF3800 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7133.08 Da Isoelectric Point: 4.5837
>NTDB_id=1137333 DQL34_RS00365 WP_111679075.1 61041..61229(+) (prx) [Streptococcus thermophilus strain NCTC12958]
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
Nucleotide
Download Length: 189 bp
>NTDB_id=1137333 DQL34_RS00365 WP_111679075.1 61041..61229(+) (prx) [Streptococcus thermophilus strain NCTC12958]
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS8232 |
59.322 |
95.161 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
57.627 |
95.161 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
69.355 |
0.516 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |