Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM35_RS04225 | Genome accession | NZ_LS483338 |
| Coordinates | 792862..793050 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain NCTC12064 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 769618..795879 | 792862..793050 | within | 0 |
Gene organization within MGE regions
Location: 769618..795879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM35_RS04035 (NCTC12064_00790) | - | 769618..770238 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQM35_RS04040 (NCTC12064_00791) | - | 770601..771689 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DQM35_RS04045 (NCTC12064_00792) | - | 771810..772703 (-) | 894 | WP_038431403.1 | P63C domain-containing protein | - |
| DQM35_RS04050 (NCTC12064_00793) | - | 772739..773563 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| DQM35_RS04055 (NCTC12064_00795) | - | 773920..774078 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQM35_RS04060 (NCTC12064_00796) | - | 774108..774707 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQM35_RS04065 (NCTC12064_00797) | - | 774761..774970 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DQM35_RS04070 (NCTC12064_00798) | - | 774959..775345 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DQM35_RS04075 (NCTC12064_00799) | - | 775419..775619 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| DQM35_RS04080 (NCTC12064_00800) | - | 775729..775938 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| DQM35_RS04085 (NCTC12064_00801) | - | 776069..776578 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DQM35_RS04095 (NCTC12064_00803) | - | 776837..777046 (-) | 210 | WP_111679842.1 | hypothetical protein | - |
| DQM35_RS04100 (NCTC12064_00805) | - | 777222..777440 (-) | 219 | WP_023079659.1 | hypothetical protein | - |
| DQM35_RS04105 (NCTC12064_00806) | - | 777583..777759 (+) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| DQM35_RS04110 (NCTC12064_00807) | - | 777837..778133 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQM35_RS04115 (NCTC12064_00808) | - | 778130..778267 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| DQM35_RS04120 (NCTC12064_00810) | - | 778348..778677 (+) | 330 | WP_002984312.1 | hypothetical protein | - |
| DQM35_RS04125 (NCTC12064_00811) | - | 778677..778871 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DQM35_RS04130 (NCTC12064_00812) | - | 778868..779152 (+) | 285 | WP_002984318.1 | hypothetical protein | - |
| DQM35_RS04135 (NCTC12064_00813) | - | 779149..779832 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DQM35_RS04140 (NCTC12064_00814) | - | 779838..781271 (+) | 1434 | Protein_734 | DEAD/DEAH box helicase | - |
| DQM35_RS04145 (NCTC12064_00815) | - | 781276..781758 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DQM35_RS04150 (NCTC12064_00816) | - | 781776..783329 (+) | 1554 | WP_002984332.1 | hypothetical protein | - |
| DQM35_RS04155 (NCTC12064_00817) | - | 783607..784476 (+) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| DQM35_RS04160 (NCTC12064_00818) | - | 784496..784780 (+) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| DQM35_RS04165 (NCTC12064_00819) | - | 784764..785120 (+) | 357 | WP_032462868.1 | hypothetical protein | - |
| DQM35_RS09160 (NCTC12064_00820) | - | 785117..785348 (+) | 232 | Protein_740 | hypothetical protein | - |
| DQM35_RS04175 (NCTC12064_00821) | - | 785369..786514 (+) | 1146 | Protein_741 | gp58-like family protein | - |
| DQM35_RS04180 (NCTC12064_00822) | - | 786528..786689 (+) | 162 | WP_002987333.1 | hypothetical protein | - |
| DQM35_RS04185 (NCTC12064_00823) | - | 786692..787309 (+) | 618 | WP_111679844.1 | DUF1366 domain-containing protein | - |
| DQM35_RS04190 (NCTC12064_00824) | - | 787319..787594 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQM35_RS04195 (NCTC12064_00825) | - | 787591..787818 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQM35_RS04200 (NCTC12064_00826) | - | 787934..789142 (+) | 1209 | WP_038431388.1 | glucosaminidase domain-containing protein | - |
| DQM35_RS04205 (NCTC12064_00827) | - | 789282..789806 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQM35_RS04210 (NCTC12064_00828) | - | 789794..790660 (+) | 867 | WP_038431386.1 | DUF334 domain-containing protein | - |
| DQM35_RS04215 (NCTC12064_00829) | spem | 790964..791677 (+) | 714 | WP_038431384.1 | streptococcal pyrogenic exotoxin SpeM | - |
| DQM35_RS04220 (NCTC12064_00830) | spel | 791959..792747 (+) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| DQM35_RS04225 (NCTC12064_00831) | prx | 792862..793050 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| DQM35_RS04235 (NCTC12064_00833) | - | 793641..794255 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQM35_RS04240 (NCTC12064_00834) | - | 794386..795171 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| DQM35_RS04245 (NCTC12064_00835) | - | 795181..795879 (-) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=1137308 DQM35_RS04225 WP_011054546.1 792862..793050(+) (prx) [Streptococcus pyogenes strain NCTC12064]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1137308 DQM35_RS04225 WP_011054546.1 792862..793050(+) (prx) [Streptococcus pyogenes strain NCTC12064]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |