Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL44_RS07145 | Genome accession | NZ_LS483335 |
| Coordinates | 1353352..1353534 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain NCTC8332 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1353352..1392128 | 1353352..1353534 | within | 0 |
Gene organization within MGE regions
Location: 1353352..1392128
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL44_RS07145 (NCTC8332_01437) | prx | 1353352..1353534 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| DQL44_RS07150 (NCTC8332_01438) | speA | 1353755..1354510 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQL44_RS07155 (NCTC8332_01439) | - | 1354632..1355291 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| DQL44_RS07160 (NCTC8332_01440) | - | 1355291..1355512 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL44_RS07165 (NCTC8332_01441) | - | 1355522..1356295 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| DQL44_RS07170 (NCTC8332_01442) | - | 1356306..1356908 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQL44_RS07175 (NCTC8332_01443) | - | 1356920..1357684 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQL44_RS07180 (NCTC8332_01444) | - | 1357686..1358018 (-) | 333 | WP_011054798.1 | phage holin | - |
| DQL44_RS07185 (NCTC8332_01445) | - | 1358018..1358341 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL44_RS10445 (NCTC8332_01446) | - | 1358355..1358477 (-) | 123 | WP_269458599.1 | hypothetical protein | - |
| DQL44_RS07190 (NCTC8332_01447) | - | 1358491..1358838 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL44_RS07195 (NCTC8332_01448) | - | 1358849..1360711 (-) | 1863 | WP_111677394.1 | DUF859 family phage minor structural protein | - |
| DQL44_RS07200 (NCTC8332_01449) | - | 1360716..1364156 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| DQL44_RS07205 (NCTC8332_01450) | - | 1364157..1365641 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DQL44_RS07210 (NCTC8332_01451) | - | 1365642..1367448 (-) | 1807 | Protein_1369 | phage tail protein | - |
| DQL44_RS07215 (NCTC8332_01453) | - | 1367441..1367899 (-) | 459 | WP_111677395.1 | hypothetical protein | - |
| DQL44_RS07220 (NCTC8332_01454) | - | 1367872..1368189 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| DQL44_RS07225 (NCTC8332_01455) | - | 1368202..1368708 (-) | 507 | WP_111677396.1 | phage major tail protein, TP901-1 family | - |
| DQL44_RS07230 (NCTC8332_01456) | - | 1368720..1369130 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DQL44_RS07235 (NCTC8332_01457) | - | 1369132..1369527 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| DQL44_RS07240 (NCTC8332_01458) | - | 1369524..1369835 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| DQL44_RS07245 (NCTC8332_01459) | - | 1369832..1370176 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| DQL44_RS07250 (NCTC8332_01460) | - | 1370190..1370483 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DQL44_RS07255 (NCTC8332_01461) | - | 1370496..1371386 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQL44_RS07260 (NCTC8332_01462) | - | 1371404..1371976 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| DQL44_RS07265 (NCTC8332_01463) | - | 1372126..1372392 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| DQL44_RS07270 (NCTC8332_01464) | - | 1372399..1373307 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| DQL44_RS07275 (NCTC8332_01465) | - | 1373276..1374601 (-) | 1326 | WP_009880265.1 | phage portal protein | - |
| DQL44_RS07280 (NCTC8332_01466) | - | 1374601..1375875 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DQL44_RS07285 (NCTC8332_01467) | - | 1375865..1376245 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQL44_RS07290 (NCTC8332_01468) | - | 1376855..1377289 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL44_RS10180 (NCTC8332_01469) | - | 1377574..1377744 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| DQL44_RS07295 (NCTC8332_01470) | - | 1377741..1378244 (-) | 504 | WP_111677397.1 | DUF1642 domain-containing protein | - |
| DQL44_RS07300 (NCTC8332_01471) | - | 1378531..1378716 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| DQL44_RS07305 (NCTC8332_01472) | - | 1378882..1379217 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| DQL44_RS07310 (NCTC8332_01473) | - | 1379220..1379504 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| DQL44_RS10185 (NCTC8332_01474) | - | 1379501..1379671 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| DQL44_RS07315 (NCTC8332_01475) | - | 1379668..1380081 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| DQL44_RS07320 (NCTC8332_01476) | - | 1380078..1380362 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| DQL44_RS10500 (NCTC8332_01477) | - | 1380356..1380607 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| DQL44_RS07330 (NCTC8332_01478) | - | 1380604..1380960 (-) | 357 | WP_111677398.1 | hypothetical protein | - |
| DQL44_RS07335 (NCTC8332_01479) | - | 1380944..1381264 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| DQL44_RS07340 (NCTC8332_01480) | - | 1381410..1382273 (-) | 864 | WP_002987985.1 | IS982-like element ISSpy2 family transposase | - |
| DQL44_RS07350 (NCTC8332_01481) | - | 1382478..1383959 (-) | 1482 | WP_023611301.1 | DNA primase family protein | - |
| DQL44_RS07355 (NCTC8332_01482) | - | 1383949..1384761 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQL44_RS07360 (NCTC8332_01483) | - | 1384764..1385222 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQL44_RS07365 (NCTC8332_01484) | - | 1385237..1386466 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQL44_RS07370 (NCTC8332_01485) | - | 1386568..1387248 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL44_RS07375 (NCTC8332_01486) | - | 1387249..1387731 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQL44_RS07380 (NCTC8332_01487) | - | 1387879..1388193 (-) | 315 | WP_063812425.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS10190 (NCTC8332_01488) | - | 1388209..1388346 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| DQL44_RS07385 (NCTC8332_01489) | - | 1388377..1388628 (-) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| DQL44_RS07390 (NCTC8332_01490) | - | 1388723..1388941 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS07395 (NCTC8332_01491) | - | 1389130..1389489 (+) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS07400 (NCTC8332_01492) | - | 1389473..1389850 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL44_RS10195 (NCTC8332_01493) | - | 1389861..1390013 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| DQL44_RS07405 (NCTC8332_01494) | - | 1390184..1390870 (+) | 687 | WP_043885029.1 | hypothetical protein | - |
| DQL44_RS10345 (NCTC8332_01495) | - | 1391044..1391712 (+) | 669 | WP_231871137.1 | phage integrase SAM-like domain-containing protein | - |
| DQL44_RS10350 (NCTC8332_01496) | - | 1391736..1392128 (+) | 393 | WP_231871138.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=1137149 DQL44_RS07145 WP_011054793.1 1353352..1353534(-) (prx) [Streptococcus pyogenes strain NCTC8332]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1137149 DQL44_RS07145 WP_011054793.1 1353352..1353534(-) (prx) [Streptococcus pyogenes strain NCTC8332]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |