Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL44_RS06380 | Genome accession | NZ_LS483335 |
| Coordinates | 1207693..1207875 (-) | Length | 60 a.a. |
| NCBI ID | WP_111677352.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8332 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1207693..1250961 | 1207693..1207875 | within | 0 |
Gene organization within MGE regions
Location: 1207693..1250961
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL44_RS06380 (NCTC8332_01278) | prx | 1207693..1207875 (-) | 183 | WP_111677352.1 | Paratox | Regulator |
| DQL44_RS06385 (NCTC8332_01279) | mf2 | 1208115..1208873 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQL44_RS06390 (NCTC8332_01280) | speC | 1208984..1209691 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL44_RS06395 (NCTC8332_01281) | - | 1209760..1210512 (-) | 753 | WP_002993615.1 | CHAP domain-containing protein | - |
| DQL44_RS06400 (NCTC8332_01283) | - | 1210630..1211085 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| DQL44_RS06405 (NCTC8332_01284) | - | 1211096..1211734 (-) | 639 | WP_023610893.1 | hypothetical protein | - |
| DQL44_RS06410 (NCTC8332_01285) | - | 1211737..1212165 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| DQL44_RS06415 (NCTC8332_01286) | - | 1212177..1214063 (-) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| DQL44_RS06420 (NCTC8332_01287) | hylP | 1214076..1215098 (-) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| DQL44_RS06425 (NCTC8332_01288) | - | 1215095..1217239 (-) | 2145 | WP_111677353.1 | phage tail spike protein | - |
| DQL44_RS06430 (NCTC8332_01289) | - | 1217236..1217943 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DQL44_RS06435 (NCTC8332_01290) | - | 1217943..1221866 (-) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| DQL44_RS10150 (NCTC8332_01291) | - | 1221879..1222046 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| DQL44_RS06440 (NCTC8332_01292) | gpG | 1222076..1222402 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DQL44_RS06445 (NCTC8332_01293) | - | 1222455..1223063 (-) | 609 | WP_014411858.1 | major tail protein | - |
| DQL44_RS06450 (NCTC8332_01294) | - | 1223080..1223505 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| DQL44_RS06455 (NCTC8332_01295) | - | 1223502..1223879 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL44_RS06460 (NCTC8332_01296) | - | 1223876..1224223 (-) | 348 | WP_002985351.1 | phage head closure protein | - |
| DQL44_RS06465 (NCTC8332_01297) | - | 1224220..1224522 (-) | 303 | WP_014411860.1 | head-tail connector protein | - |
| DQL44_RS10155 | - | 1224525..1224671 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| DQL44_RS06470 (NCTC8332_01298) | - | 1224658..1225860 (-) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| DQL44_RS06475 (NCTC8332_01299) | - | 1225886..1226551 (-) | 666 | WP_023610933.1 | head maturation protease, ClpP-related | - |
| DQL44_RS06480 (NCTC8332_01300) | - | 1226529..1227749 (-) | 1221 | WP_014411863.1 | phage portal protein | - |
| DQL44_RS06485 (NCTC8332_01301) | - | 1227783..1228007 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQL44_RS10160 (NCTC8332_01302) | - | 1228000..1228170 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQL44_RS06490 (NCTC8332_01303) | - | 1228167..1229921 (-) | 1755 | WP_014411864.1 | terminase large subunit | - |
| DQL44_RS06495 (NCTC8332_01304) | - | 1229936..1230403 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQL44_RS06500 (NCTC8332_01305) | - | 1230574..1230912 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQL44_RS06510 (NCTC8332_01306) | - | 1231497..1231937 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL44_RS06515 (NCTC8332_01307) | - | 1232213..1232584 (-) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQL44_RS06520 (NCTC8332_01308) | - | 1232581..1233291 (-) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQL44_RS06525 (NCTC8332_01309) | - | 1233294..1233926 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQL44_RS06530 (NCTC8332_01310) | - | 1233928..1234212 (-) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQL44_RS06535 (NCTC8332_01311) | - | 1234209..1234613 (-) | 405 | WP_014411871.1 | YopX family protein | - |
| DQL44_RS06540 (NCTC8332_01312) | - | 1234623..1234892 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQL44_RS06545 (NCTC8332_01313) | - | 1234889..1235173 (-) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| DQL44_RS10495 (NCTC8332_01314) | - | 1235167..1235407 (-) | 241 | Protein_1237 | hypothetical protein | - |
| DQL44_RS06555 (NCTC8332_01315) | - | 1235404..1235760 (-) | 357 | WP_111677355.1 | hypothetical protein | - |
| DQL44_RS06560 (NCTC8332_01316) | - | 1235744..1236064 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DQL44_RS06565 (NCTC8332_01317) | - | 1236061..1236474 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQL44_RS06570 (NCTC8332_01318) | - | 1236736..1238211 (-) | 1476 | WP_111704453.1 | DNA primase family protein | - |
| DQL44_RS06575 (NCTC8332_01319) | - | 1238201..1239013 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DQL44_RS06580 (NCTC8332_01320) | - | 1239016..1239474 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQL44_RS06585 (NCTC8332_01321) | - | 1239489..1240718 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DQL44_RS06590 (NCTC8332_01322) | - | 1240820..1241500 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQL44_RS06595 (NCTC8332_01323) | - | 1241501..1241983 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQL44_RS06600 (NCTC8332_01324) | - | 1242131..1242445 (-) | 315 | WP_063812425.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS10165 (NCTC8332_01325) | - | 1242461..1242598 (-) | 138 | WP_168390507.1 | hypothetical protein | - |
| DQL44_RS06605 (NCTC8332_01326) | - | 1242600..1242911 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQL44_RS06610 (NCTC8332_01327) | - | 1242989..1243174 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS06615 (NCTC8332_01328) | - | 1243341..1243580 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQL44_RS06620 (NCTC8332_01329) | - | 1243731..1243940 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQL44_RS06630 (NCTC8332_01331) | - | 1244193..1244999 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQL44_RS06640 (NCTC8332_01333) | - | 1245211..1245450 (-) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| DQL44_RS06645 (NCTC8332_01334) | - | 1245544..1246143 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQL44_RS06650 (NCTC8332_01335) | - | 1246173..1246331 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQL44_RS06655 (NCTC8332_01337) | - | 1246704..1247492 (+) | 789 | WP_014411883.1 | S24 family peptidase | - |
| DQL44_RS06660 (NCTC8332_01338) | - | 1247502..1247807 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DQL44_RS06665 (NCTC8332_01339) | - | 1247930..1249072 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL44_RS06670 (NCTC8332_01340) | - | 1249162..1249437 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL44_RS06675 (NCTC8332_01341) | - | 1249536..1250123 (-) | 588 | WP_111677357.1 | YpmS family protein | - |
| DQL44_RS06680 (NCTC8332_01342) | - | 1250101..1250943 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7051.01 Da Isoelectric Point: 4.1079
>NTDB_id=1137146 DQL44_RS06380 WP_111677352.1 1207693..1207875(-) (prx) [Streptococcus pyogenes strain NCTC8332]
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1137146 DQL44_RS06380 WP_111677352.1 1207693..1207875(-) (prx) [Streptococcus pyogenes strain NCTC8332]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |