Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM36_RS06565 | Genome accession | NZ_LS483332 |
| Coordinates | 1275794..1275976 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017399.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12696 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1272790..1314626 | 1275794..1275976 | within | 0 |
Gene organization within MGE regions
Location: 1272790..1314626
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM36_RS06555 (NCTC12696_01288) | recU | 1272790..1273398 (+) | 609 | WP_002983622.1 | Holliday junction resolvase RecU | - |
| DQM36_RS06560 (NCTC12696_01289) | pbp1a | 1273385..1275550 (+) | 2166 | WP_023609908.1 | penicillin-binding protein PBP1A | - |
| DQM36_RS06565 (NCTC12696_01291) | prx | 1275794..1275976 (-) | 183 | WP_011017399.1 | hypothetical protein | Regulator |
| DQM36_RS06570 (NCTC12696_01292) | speA | 1276197..1276952 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQM36_RS06575 (NCTC12696_01293) | - | 1277074..1278291 (-) | 1218 | WP_023611377.1 | peptidoglycan amidohydrolase family protein | - |
| DQM36_RS06580 (NCTC12696_01295) | - | 1278410..1278637 (-) | 228 | WP_003058873.1 | phage holin | - |
| DQM36_RS06585 (NCTC12696_01296) | - | 1278634..1278906 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM36_RS06590 (NCTC12696_01297) | - | 1278918..1279550 (-) | 633 | WP_023611372.1 | hypothetical protein | - |
| DQM36_RS06595 (NCTC12696_01298) | - | 1279553..1279981 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQM36_RS06600 (NCTC12696_01299) | - | 1279993..1281897 (-) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| DQM36_RS06605 (NCTC12696_01300) | - | 1281907..1282914 (-) | 1008 | WP_011017394.1 | hyaluronoglucosaminidase | - |
| DQM36_RS06610 (NCTC12696_01301) | - | 1282911..1284962 (-) | 2052 | WP_038432431.1 | phage tail spike protein | - |
| DQM36_RS06615 (NCTC12696_01302) | - | 1284959..1285729 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| DQM36_RS06620 (NCTC12696_01303) | - | 1285742..1289842 (-) | 4101 | WP_023611657.1 | phage tail tape measure protein | - |
| DQM36_RS06630 (NCTC12696_01304) | gpG | 1290068..1290370 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| DQM36_RS06635 (NCTC12696_01305) | - | 1290463..1291047 (-) | 585 | WP_011017389.1 | major tail protein | - |
| DQM36_RS06640 (NCTC12696_01306) | - | 1291059..1291439 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| DQM36_RS06645 (NCTC12696_01307) | - | 1291432..1291830 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| DQM36_RS06650 (NCTC12696_01308) | - | 1291832..1292194 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| DQM36_RS06655 (NCTC12696_01309) | - | 1292187..1292495 (-) | 309 | WP_011017385.1 | hypothetical protein | - |
| DQM36_RS09650 (NCTC12696_01310) | - | 1292495..1292668 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| DQM36_RS06660 (NCTC12696_01311) | - | 1292682..1293815 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| DQM36_RS06665 (NCTC12696_01312) | - | 1293832..1294638 (-) | 807 | WP_023611660.1 | head maturation protease, ClpP-related | - |
| DQM36_RS06670 (NCTC12696_01313) | - | 1294619..1295806 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| DQM36_RS06675 (NCTC12696_01314) | - | 1295959..1296171 (-) | 213 | WP_225793055.1 | hypothetical protein | - |
| DQM36_RS06680 (NCTC12696_01315) | - | 1296174..1297904 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| DQM36_RS06685 (NCTC12696_01316) | - | 1297917..1298234 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| DQM36_RS06690 (NCTC12696_01317) | - | 1298375..1298680 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| DQM36_RS06695 (NCTC12696_01318) | - | 1298673..1299059 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| DQM36_RS06700 (NCTC12696_01319) | - | 1299085..1299288 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| DQM36_RS06705 (NCTC12696_01320) | - | 1299346..1299639 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| DQM36_RS06710 (NCTC12696_01321) | - | 1299793..1300368 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| DQM36_RS06715 (NCTC12696_01322) | - | 1300528..1300929 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| DQM36_RS06720 (NCTC12696_01323) | - | 1300944..1301771 (-) | 828 | WP_011017372.1 | prohibitin family protein | - |
| DQM36_RS06725 (NCTC12696_01324) | - | 1301774..1302112 (-) | 339 | WP_011017371.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS06730 (NCTC12696_01325) | - | 1302109..1302390 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| DQM36_RS06735 (NCTC12696_01326) | ssbA | 1302405..1302797 (-) | 393 | WP_011017370.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM36_RS06740 (NCTC12696_01327) | - | 1302794..1303015 (-) | 222 | WP_011017369.1 | hypothetical protein | - |
| DQM36_RS06745 (NCTC12696_01328) | - | 1303012..1303497 (-) | 486 | WP_011017368.1 | DUF1642 domain-containing protein | - |
| DQM36_RS06750 (NCTC12696_01329) | - | 1303502..1304134 (-) | 633 | WP_023611652.1 | N-6 DNA methylase | - |
| DQM36_RS06755 (NCTC12696_01330) | - | 1304136..1304405 (-) | 270 | WP_011017366.1 | hypothetical protein | - |
| DQM36_RS09655 (NCTC12696_01331) | - | 1304402..1304572 (-) | 171 | WP_023611649.1 | hypothetical protein | - |
| DQM36_RS06760 (NCTC12696_01332) | - | 1304569..1305012 (-) | 444 | WP_011017365.1 | YopX family protein | - |
| DQM36_RS09870 (NCTC12696_01333) | - | 1305029..1305154 (-) | 126 | WP_257000584.1 | hypothetical protein | - |
| DQM36_RS06765 (NCTC12696_01334) | - | 1305168..1305395 (-) | 228 | WP_032467212.1 | hypothetical protein | - |
| DQM36_RS06770 (NCTC12696_01335) | - | 1305395..1306207 (-) | 813 | WP_023611651.1 | ATP-binding protein | - |
| DQM36_RS06775 (NCTC12696_01336) | - | 1306207..1306968 (-) | 762 | WP_011017361.1 | conserved phage C-terminal domain-containing protein | - |
| DQM36_RS06780 (NCTC12696_01337) | dnaB | 1306961..1308301 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| DQM36_RS06785 (NCTC12696_01338) | - | 1308288..1308476 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| DQM36_RS09875 | - | 1308479..1308610 (-) | 132 | WP_261676415.1 | hypothetical protein | - |
| DQM36_RS06790 (NCTC12696_01339) | - | 1308597..1308788 (-) | 192 | WP_038432436.1 | hypothetical protein | - |
| DQM36_RS06795 (NCTC12696_01340) | - | 1308881..1309138 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| DQM36_RS06800 (NCTC12696_01341) | - | 1309212..1309931 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| DQM36_RS06805 (NCTC12696_01342) | - | 1309983..1310483 (+) | 501 | WP_032464978.1 | hypothetical protein | - |
| DQM36_RS09880 (NCTC12696_01343) | - | 1310603..1310737 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| DQM36_RS06810 (NCTC12696_01344) | - | 1310811..1311023 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS06815 (NCTC12696_01345) | - | 1311058..1311333 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| DQM36_RS06820 (NCTC12696_01346) | - | 1311622..1311972 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS06825 (NCTC12696_01347) | - | 1311976..1312368 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM36_RS06830 (NCTC12696_01348) | - | 1312379..1313119 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM36_RS06835 (NCTC12696_01349) | - | 1313430..1314626 (+) | 1197 | WP_011017350.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6989.07 Da Isoelectric Point: 4.3094
>NTDB_id=1136983 DQM36_RS06565 WP_011017399.1 1275794..1275976(-) (prx) [Streptococcus pyogenes strain NCTC12696]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPGEGVRPWEVLTEEKVEEVMRELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPGEGVRPWEVLTEEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136983 DQM36_RS06565 WP_011017399.1 1275794..1275976(-) (prx) [Streptococcus pyogenes strain NCTC12696]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCAGGAGAGGGAGTCAGGCCATGGGAGGTGTTGACAGAGGAAAAAGTGGAAGAAG
TGATGAGGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCAGGAGAGGGAGTCAGGCCATGGGAGGTGTTGACAGAGGAAAAAGTGGAAGAAG
TGATGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
95.122 |
68.333 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
68.333 |
0.517 |