Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM36_RS05545 | Genome accession | NZ_LS483332 |
| Coordinates | 1089444..1089626 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12696 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1089444..1135321 | 1089444..1089626 | within | 0 |
Gene organization within MGE regions
Location: 1089444..1135321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM36_RS05545 (NCTC12696_01089) | prx | 1089444..1089626 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| DQM36_RS05555 (NCTC12696_01091) | - | 1089972..1090547 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQM36_RS05560 (NCTC12696_01092) | spek | 1091023..1091802 (-) | 780 | WP_038432391.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DQM36_RS05565 (NCTC12696_01093) | - | 1092106..1092972 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| DQM36_RS05570 (NCTC12696_01094) | - | 1092960..1093484 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| DQM36_RS05575 (NCTC12696_01095) | - | 1093624..1094832 (-) | 1209 | WP_014411848.1 | glucosaminidase domain-containing protein | - |
| DQM36_RS05580 (NCTC12696_01097) | - | 1094948..1095175 (-) | 228 | WP_003058873.1 | phage holin | - |
| DQM36_RS05585 (NCTC12696_01098) | - | 1095172..1095447 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQM36_RS05590 (NCTC12696_01099) | - | 1095457..1096095 (-) | 639 | WP_023610893.1 | hypothetical protein | - |
| DQM36_RS05595 (NCTC12696_01100) | - | 1096098..1096526 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| DQM36_RS05600 (NCTC12696_01101) | - | 1096538..1098424 (-) | 1887 | WP_014411851.1 | gp58-like family protein | - |
| DQM36_RS05605 (NCTC12696_01102) | hylP | 1098437..1099459 (-) | 1023 | WP_014411852.1 | hyaluronidase HylP | - |
| DQM36_RS05610 (NCTC12696_01103) | - | 1099456..1101600 (-) | 2145 | WP_014411853.1 | phage tail spike protein | - |
| DQM36_RS05615 (NCTC12696_01104) | - | 1101597..1102304 (-) | 708 | WP_014411854.1 | distal tail protein Dit | - |
| DQM36_RS05620 (NCTC12696_01105) | - | 1102304..1106227 (-) | 3924 | WP_014411855.1 | phage tail tape measure protein | - |
| DQM36_RS09630 (NCTC12696_01106) | - | 1106240..1106407 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| DQM36_RS05625 (NCTC12696_01107) | gpG | 1106437..1106763 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| DQM36_RS05630 (NCTC12696_01108) | - | 1106816..1107424 (-) | 609 | WP_014411858.1 | major tail protein | - |
| DQM36_RS05635 (NCTC12696_01109) | - | 1107441..1107866 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| DQM36_RS05640 (NCTC12696_01110) | - | 1107863..1108240 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM36_RS05645 (NCTC12696_01111) | - | 1108237..1108584 (-) | 348 | WP_002985351.1 | phage head closure protein | - |
| DQM36_RS05650 (NCTC12696_01112) | - | 1108581..1108883 (-) | 303 | WP_014411860.1 | head-tail connector protein | - |
| DQM36_RS09635 | - | 1108886..1109032 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| DQM36_RS05655 (NCTC12696_01113) | - | 1109019..1110221 (-) | 1203 | WP_014411862.1 | phage major capsid protein | - |
| DQM36_RS05660 (NCTC12696_01114) | - | 1110247..1110912 (-) | 666 | WP_023610933.1 | head maturation protease, ClpP-related | - |
| DQM36_RS05665 (NCTC12696_01115) | - | 1110890..1112110 (-) | 1221 | WP_014411863.1 | phage portal protein | - |
| DQM36_RS05670 (NCTC12696_01116) | - | 1112144..1112368 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQM36_RS09640 (NCTC12696_01117) | - | 1112361..1112531 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQM36_RS05675 (NCTC12696_01118) | - | 1112528..1114282 (-) | 1755 | WP_014411864.1 | terminase large subunit | - |
| DQM36_RS05680 (NCTC12696_01119) | - | 1114297..1114764 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQM36_RS05685 (NCTC12696_01120) | - | 1114935..1115273 (-) | 339 | WP_002985375.1 | HNH endonuclease | - |
| DQM36_RS05695 (NCTC12696_01121) | - | 1115858..1116298 (-) | 441 | WP_014411867.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQM36_RS05700 (NCTC12696_01122) | - | 1116574..1116945 (-) | 372 | WP_014411868.1 | hypothetical protein | - |
| DQM36_RS05705 (NCTC12696_01123) | - | 1116942..1117652 (-) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| DQM36_RS05710 (NCTC12696_01124) | - | 1117655..1118287 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DQM36_RS05715 (NCTC12696_01125) | - | 1118289..1118573 (-) | 285 | WP_014411870.1 | hypothetical protein | - |
| DQM36_RS05720 (NCTC12696_01126) | - | 1118570..1118974 (-) | 405 | WP_014411871.1 | YopX family protein | - |
| DQM36_RS05725 (NCTC12696_01127) | - | 1118984..1119253 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| DQM36_RS05730 (NCTC12696_01128) | - | 1119250..1119534 (-) | 285 | WP_014411872.1 | DUF3310 domain-containing protein | - |
| DQM36_RS09930 (NCTC12696_01129) | - | 1119528..1119768 (-) | 241 | Protein_1057 | hypothetical protein | - |
| DQM36_RS05740 | - | 1119765..1120122 (-) | 358 | Protein_1058 | hypothetical protein | - |
| DQM36_RS05745 (NCTC12696_01131) | - | 1120106..1120426 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| DQM36_RS05750 (NCTC12696_01132) | - | 1120423..1120836 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| DQM36_RS05755 (NCTC12696_01133) | - | 1121098..1122573 (-) | 1476 | WP_014411876.1 | DNA primase family protein | - |
| DQM36_RS05760 (NCTC12696_01134) | - | 1122563..1123375 (-) | 813 | WP_014411877.1 | bifunctional DNA primase/polymerase | - |
| DQM36_RS05765 (NCTC12696_01135) | - | 1123378..1123836 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DQM36_RS05770 (NCTC12696_01136) | - | 1123852..1125081 (-) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| DQM36_RS05775 (NCTC12696_01137) | - | 1125183..1125863 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DQM36_RS05780 (NCTC12696_01138) | - | 1125864..1126346 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DQM36_RS05785 (NCTC12696_01139) | - | 1126494..1126808 (-) | 315 | WP_014411879.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS09860 (NCTC12696_01140) | - | 1126824..1126958 (-) | 135 | WP_012560975.1 | hypothetical protein | - |
| DQM36_RS05790 (NCTC12696_01141) | - | 1126960..1127271 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQM36_RS05795 (NCTC12696_01142) | - | 1127349..1127534 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS05800 (NCTC12696_01143) | - | 1127701..1127940 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQM36_RS05805 (NCTC12696_01144) | - | 1128091..1128300 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQM36_RS05815 (NCTC12696_01146) | - | 1128553..1129359 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| DQM36_RS05825 (NCTC12696_01148) | - | 1129571..1129810 (-) | 240 | WP_014411882.1 | helix-turn-helix domain-containing protein | - |
| DQM36_RS05830 (NCTC12696_01149) | - | 1129904..1130503 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| DQM36_RS05835 (NCTC12696_01150) | - | 1130533..1130691 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| DQM36_RS05840 (NCTC12696_01152) | - | 1131064..1131852 (+) | 789 | WP_014411883.1 | S24 family peptidase | - |
| DQM36_RS05845 (NCTC12696_01153) | - | 1131862..1132167 (+) | 306 | WP_011106738.1 | membrane protein | - |
| DQM36_RS05850 (NCTC12696_01154) | - | 1132290..1133432 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQM36_RS05855 (NCTC12696_01155) | - | 1133522..1133797 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQM36_RS05860 (NCTC12696_01156) | - | 1133896..1134483 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQM36_RS05865 (NCTC12696_01157) | - | 1134461..1135303 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1136976 DQM36_RS05545 WP_011017964.1 1089444..1089626(-) (prx) [Streptococcus pyogenes strain NCTC12696]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136976 DQM36_RS05545 WP_011017964.1 1089444..1089626(-) (prx) [Streptococcus pyogenes strain NCTC12696]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |