Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL25_RS03245 | Genome accession | NZ_LS483330 |
| Coordinates | 598223..598405 (+) | Length | 60 a.a. |
| NCBI ID | WP_111703187.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8328 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 561916..598405 | 598223..598405 | within | 0 |
Gene organization within MGE regions
Location: 561916..598405
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL25_RS02970 (NCTC8328_00586) | - | 561916..563082 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| DQL25_RS02975 (NCTC8328_00587) | - | 563256..563942 (-) | 687 | WP_043885029.1 | hypothetical protein | - |
| DQL25_RS09565 (NCTC8328_00588) | - | 564113..564265 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| DQL25_RS02980 (NCTC8328_00589) | - | 564276..564653 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL25_RS02985 (NCTC8328_00590) | - | 564637..564996 (-) | 360 | WP_011528540.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS02990 (NCTC8328_00591) | - | 565185..565403 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS02995 (NCTC8328_00592) | - | 565498..565749 (+) | 252 | WP_011528542.1 | helix-turn-helix transcriptional regulator | - |
| DQL25_RS09820 (NCTC8328_00593) | - | 565780..565914 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| DQL25_RS03000 (NCTC8328_00594) | - | 565930..566247 (+) | 318 | WP_111703179.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS03005 (NCTC8328_00595) | - | 566261..567163 (+) | 903 | WP_085613680.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQL25_RS03010 (NCTC8328_00596) | - | 567173..568015 (+) | 843 | WP_063629027.1 | ATP-binding protein | - |
| DQL25_RS09690 (NCTC8328_00597) | - | 568015..568152 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| DQL25_RS03015 (NCTC8328_00598) | - | 568165..568518 (+) | 354 | WP_111703180.1 | hypothetical protein | - |
| DQL25_RS03020 (NCTC8328_00599) | - | 568499..568753 (+) | 255 | WP_111703181.1 | hypothetical protein | - |
| DQL25_RS03025 (NCTC8328_00600) | - | 568775..569257 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| DQL25_RS03030 (NCTC8328_00601) | - | 569258..569932 (+) | 675 | WP_111703182.1 | ERF family protein | - |
| DQL25_RS03035 (NCTC8328_00602) | ssb | 569925..570416 (+) | 492 | WP_038433322.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL25_RS03040 | - | 570422..570625 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQL25_RS03045 (NCTC8328_00603) | - | 570625..571065 (+) | 441 | WP_111703183.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL25_RS03050 (NCTC8328_00604) | - | 571062..571418 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQL25_RS09870 (NCTC8328_00605) | - | 571415..571666 (+) | 252 | WP_032459778.1 | hypothetical protein | - |
| DQL25_RS03060 (NCTC8328_00606) | - | 571660..571882 (+) | 223 | Protein_540 | hypothetical protein | - |
| DQL25_RS03065 (NCTC8328_00607) | - | 571879..572292 (+) | 414 | WP_111703184.1 | YopX family protein | - |
| DQL25_RS03070 (NCTC8328_00608) | - | 572289..572573 (+) | 285 | WP_111703185.1 | hypothetical protein | - |
| DQL25_RS03075 (NCTC8328_00609) | - | 572577..573062 (+) | 486 | WP_111703186.1 | class I SAM-dependent methyltransferase | - |
| DQL25_RS03080 (NCTC8328_00610) | - | 573066..573293 (+) | 228 | WP_021340166.1 | hypothetical protein | - |
| DQL25_RS03085 (NCTC8328_00611) | - | 573318..573503 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| DQL25_RS03090 (NCTC8328_00612) | - | 573500..573793 (+) | 294 | WP_032461639.1 | hypothetical protein | - |
| DQL25_RS03095 (NCTC8328_00613) | - | 573790..574293 (+) | 504 | WP_032461638.1 | DUF1642 domain-containing protein | - |
| DQL25_RS09570 (NCTC8328_00614) | - | 574290..574460 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DQL25_RS03100 (NCTC8328_00615) | - | 574734..575168 (+) | 435 | WP_032461637.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL25_RS03105 (NCTC8328_00616) | - | 575517..575897 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DQL25_RS03110 (NCTC8328_00617) | - | 575887..577161 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DQL25_RS03115 (NCTC8328_00618) | - | 577161..578486 (+) | 1326 | WP_009880265.1 | phage portal protein | - |
| DQL25_RS03120 (NCTC8328_00619) | - | 578455..579363 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| DQL25_RS03125 (NCTC8328_00620) | - | 579370..579636 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| DQL25_RS03130 (NCTC8328_00621) | - | 579786..580355 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| DQL25_RS03135 (NCTC8328_00622) | - | 580373..581263 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DQL25_RS03140 (NCTC8328_00623) | - | 581275..581568 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DQL25_RS03145 (NCTC8328_00624) | - | 581582..581926 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| DQL25_RS03150 (NCTC8328_00625) | - | 581923..582234 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| DQL25_RS03155 (NCTC8328_00626) | - | 582231..582626 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| DQL25_RS03160 (NCTC8328_00627) | - | 582628..583038 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DQL25_RS03165 (NCTC8328_00628) | - | 583050..583556 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| DQL25_RS03170 (NCTC8328_00629) | - | 583569..583886 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| DQL25_RS03175 (NCTC8328_00630) | - | 583859..584317 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| DQL25_RS03180 (NCTC8328_00631) | - | 584310..586115 (+) | 1806 | WP_011054802.1 | tail protein | - |
| DQL25_RS03185 (NCTC8328_00632) | - | 586116..587600 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DQL25_RS03190 (NCTC8328_00633) | - | 587601..591041 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| DQL25_RS03195 (NCTC8328_00634) | - | 591046..592908 (+) | 1863 | WP_009880248.1 | DUF859 family phage minor structural protein | - |
| DQL25_RS03200 (NCTC8328_00635) | - | 592919..593266 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL25_RS09825 (NCTC8328_00636) | - | 593280..593402 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQL25_RS03205 (NCTC8328_00637) | - | 593416..593739 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL25_RS03210 (NCTC8328_00638) | - | 593739..594071 (+) | 333 | WP_011054798.1 | phage holin | - |
| DQL25_RS03215 (NCTC8328_00639) | - | 594073..594837 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DQL25_RS03220 (NCTC8328_00640) | - | 594849..595451 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DQL25_RS03225 (NCTC8328_00641) | - | 595462..596235 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| DQL25_RS03230 (NCTC8328_00642) | - | 596245..596466 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL25_RS03235 (NCTC8328_00643) | - | 596466..597125 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| DQL25_RS03240 (NCTC8328_00644) | speA | 597247..598002 (-) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DQL25_RS03245 (NCTC8328_00645) | prx | 598223..598405 (+) | 183 | WP_111703187.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6951.96 Da Isoelectric Point: 4.2336
>NTDB_id=1136854 DQL25_RS03245 WP_111703187.1 598223..598405(+) (prx) [Streptococcus pyogenes strain NCTC8328]
MLYIDEFKEAIDKGDILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
MLYIDEFKEAIDKGDILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136854 DQL25_RS03245 WP_111703187.1 598223..598405(+) (prx) [Streptococcus pyogenes strain NCTC8328]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGGATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGGATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
96.667 |
100 |
0.967 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS8232 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |