Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL25_RS02015 | Genome accession | NZ_LS483330 |
| Coordinates | 373093..373275 (+) | Length | 60 a.a. |
| NCBI ID | WP_047149504.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8328 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 313375..378015 | 373093..373275 | within | 0 |
Gene organization within MGE regions
Location: 313375..378015
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL25_RS01680 (NCTC8328_00332) | - | 313375..314271 (-) | 897 | WP_002983050.1 | sulfite exporter TauE/SafE family protein | - |
| DQL25_RS01685 (NCTC8328_00333) | - | 314569..315321 (+) | 753 | WP_002983053.1 | CppA N-terminal domain-containing protein | - |
| DQL25_RS01690 (NCTC8328_00334) | - | 315306..316256 (+) | 951 | WP_111703135.1 | serine hydrolase domain-containing protein | - |
| DQL25_RS01695 (NCTC8328_00335) | pflB | 316436..318763 (-) | 2328 | WP_002988233.1 | formate C-acetyltransferase | - |
| DQL25_RS01700 (NCTC8328_00336) | dinB | 318972..320066 (+) | 1095 | WP_020905451.1 | DNA polymerase IV | - |
| DQL25_RS01705 (NCTC8328_00337) | - | 320159..320641 (-) | 483 | WP_002983066.1 | hypothetical protein | - |
| DQL25_RS01710 (NCTC8328_00338) | - | 320732..323185 (-) | 2454 | WP_063662393.1 | ATP-dependent RecD-like DNA helicase | - |
| DQL25_RS01715 (NCTC8328_00339) | lepB | 323243..323836 (-) | 594 | WP_002983074.1 | signal peptidase I | - |
| DQL25_RS01720 (NCTC8328_00340) | rnhC | 323847..324749 (-) | 903 | WP_002988245.1 | ribonuclease HIII | - |
| DQL25_RS01725 (NCTC8328_00341) | - | 324906..325214 (+) | 309 | WP_002993251.1 | hypothetical protein | - |
| DQL25_RS01730 (NCTC8328_00342) | - | 325217..325762 (+) | 546 | WP_002983087.1 | CvpA family protein | - |
| DQL25_RS01735 (NCTC8328_00343) | - | 325911..328250 (+) | 2340 | WP_111703136.1 | endonuclease MutS2 | - |
| DQL25_RS01740 (NCTC8328_00344) | - | 328254..328754 (+) | 501 | WP_168391425.1 | phosphatase PAP2 family protein | - |
| DQL25_RS01745 (NCTC8328_00345) | trxA | 328817..329149 (+) | 333 | WP_001932060.1 | thioredoxin | - |
| DQL25_RS01750 (NCTC8328_00346) | - | 329201..329788 (-) | 588 | WP_032462795.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS01755 (NCTC8328_00347) | mutY | 329864..331018 (-) | 1155 | WP_002988276.1 | A/G-specific adenine glycosylase | - |
| DQL25_RS01760 (NCTC8328_00348) | - | 331186..331479 (+) | 294 | WP_111703138.1 | hypothetical protein | - |
| DQL25_RS01765 (NCTC8328_00349) | rpsF | 331652..331942 (+) | 291 | WP_002983117.1 | 30S ribosomal protein S6 | - |
| DQL25_RS01770 (NCTC8328_00350) | ssb | 331964..332455 (+) | 492 | WP_111703139.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL25_RS01775 (NCTC8328_00351) | rpsR | 332620..332859 (+) | 240 | WP_002983142.1 | 30S ribosomal protein S18 | - |
| DQL25_RS01780 (NCTC8328_00352) | - | 332990..333643 (-) | 654 | WP_111703140.1 | DUF1129 domain-containing protein | - |
| DQL25_RS01785 (NCTC8328_00353) | - | 333776..334720 (-) | 945 | WP_002983147.1 | magnesium transporter CorA family protein | - |
| DQL25_RS01790 (NCTC8328_00354) | - | 334964..336061 (-) | 1098 | WP_047149517.1 | site-specific integrase | - |
| DQL25_RS01795 (NCTC8328_00355) | - | 336237..336788 (-) | 552 | WP_047149516.1 | hypothetical protein | - |
| DQL25_RS01800 (NCTC8328_00356) | - | 336799..337182 (-) | 384 | WP_047149515.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL25_RS01805 (NCTC8328_00357) | - | 337196..337546 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS01810 (NCTC8328_00358) | - | 338187..338378 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| DQL25_RS01815 (NCTC8328_00359) | - | 338429..338629 (+) | 201 | WP_227868729.1 | hypothetical protein | - |
| DQL25_RS01820 (NCTC8328_00360) | - | 338717..338974 (+) | 258 | WP_047149513.1 | hypothetical protein | - |
| DQL25_RS01825 (NCTC8328_00361) | - | 339003..339173 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQL25_RS01830 (NCTC8328_00362) | - | 339166..339369 (+) | 204 | WP_047149512.1 | hypothetical protein | - |
| DQL25_RS01835 (NCTC8328_00363) | - | 339366..339752 (+) | 387 | WP_047149511.1 | hypothetical protein | - |
| DQL25_RS01840 (NCTC8328_00365) | - | 339898..340101 (+) | 204 | WP_030127426.1 | hypothetical protein | - |
| DQL25_RS01845 (NCTC8328_00366) | - | 340189..340488 (+) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQL25_RS01850 (NCTC8328_00367) | - | 340488..341645 (+) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQL25_RS01855 (NCTC8328_00368) | - | 341654..342217 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQL25_RS01860 (NCTC8328_00369) | - | 342260..344182 (+) | 1923 | WP_047149510.1 | DNA polymerase | - |
| DQL25_RS01865 (NCTC8328_00370) | - | 344187..346571 (+) | 2385 | WP_111689469.1 | phage/plasmid primase, P4 family | - |
| DQL25_RS01870 (NCTC8328_00371) | - | 346957..347232 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQL25_RS01875 (NCTC8328_00372) | - | 347229..348551 (+) | 1323 | WP_047149508.1 | SNF2-related protein | - |
| DQL25_RS09555 (NCTC8328_00373) | - | 348552..348722 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| DQL25_RS01880 (NCTC8328_00374) | - | 348715..348987 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQL25_RS01885 (NCTC8328_00376) | - | 349120..349536 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQL25_RS01890 (NCTC8328_00377) | - | 349626..350078 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| DQL25_RS01895 (NCTC8328_00378) | - | 350068..351345 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DQL25_RS01900 (NCTC8328_00379) | - | 351361..352893 (+) | 1533 | WP_038433243.1 | phage portal protein | - |
| DQL25_RS01905 (NCTC8328_00380) | - | 352853..354301 (+) | 1449 | WP_032465703.1 | minor capsid protein | - |
| DQL25_RS01910 | - | 354329..354517 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| DQL25_RS01915 (NCTC8328_00382) | - | 354522..354788 (+) | 267 | WP_011888934.1 | hypothetical protein | - |
| DQL25_RS01920 (NCTC8328_00383) | - | 354950..355519 (+) | 570 | WP_011888933.1 | DUF4355 domain-containing protein | - |
| DQL25_RS01925 (NCTC8328_00384) | - | 355532..356419 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| DQL25_RS01930 (NCTC8328_00385) | - | 356431..356787 (+) | 357 | WP_011888932.1 | phage head-tail connector protein | - |
| DQL25_RS01935 (NCTC8328_00386) | - | 356798..357076 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| DQL25_RS01940 (NCTC8328_00387) | - | 357073..357417 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL25_RS01945 (NCTC8328_00388) | - | 357421..357780 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| DQL25_RS01950 (NCTC8328_00389) | - | 357792..358391 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| DQL25_RS01955 (NCTC8328_00390) | - | 358445..358900 (+) | 456 | WP_011888931.1 | tail assembly chaperone | - |
| DQL25_RS01960 (NCTC8328_00391) | - | 358975..359208 (+) | 234 | WP_011888930.1 | hypothetical protein | - |
| DQL25_RS01965 (NCTC8328_00392) | - | 359223..363605 (+) | 4383 | WP_111688404.1 | tape measure protein | - |
| DQL25_RS01970 (NCTC8328_00393) | - | 363617..364459 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| DQL25_RS01975 (NCTC8328_00394) | - | 364469..366448 (+) | 1980 | WP_011888928.1 | phage tail protein | - |
| DQL25_RS01980 (NCTC8328_00395) | - | 366445..367560 (+) | 1116 | WP_011888927.1 | hyaluronoglucosaminidase | - |
| DQL25_RS01985 (NCTC8328_00396) | - | 367575..369479 (+) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| DQL25_RS01990 (NCTC8328_00397) | - | 369491..369919 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQL25_RS01995 (NCTC8328_00398) | - | 369922..370560 (+) | 639 | WP_046735270.1 | hypothetical protein | - |
| DQL25_RS02000 (NCTC8328_00399) | - | 370572..370844 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQL25_RS02005 (NCTC8328_00400) | - | 370841..371068 (+) | 228 | WP_029714020.1 | phage holin | - |
| DQL25_RS02010 (NCTC8328_00402) | - | 371191..372396 (+) | 1206 | WP_047149505.1 | glucosaminidase domain-containing protein | - |
| DQL25_RS02015 (NCTC8328_00404) | prx | 373093..373275 (+) | 183 | WP_047149504.1 | hypothetical protein | Regulator |
| DQL25_RS02020 (NCTC8328_00405) | uvrA | 373502..376330 (+) | 2829 | WP_011054967.1 | excinuclease ABC subunit UvrA | - |
| DQL25_RS02025 (NCTC8328_00406) | - | 376446..377519 (+) | 1074 | WP_032460474.1 | M24 family metallopeptidase | - |
| DQL25_RS02030 (NCTC8328_00407) | - | 377554..378015 (+) | 462 | WP_002988493.1 | deoxycytidylate deaminase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6865.91 Da Isoelectric Point: 3.9764
>NTDB_id=1136846 DQL25_RS02015 WP_047149504.1 373093..373275(+) (prx) [Streptococcus pyogenes strain NCTC8328]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1136846 DQL25_RS02015 WP_047149504.1 373093..373275(+) (prx) [Streptococcus pyogenes strain NCTC8328]
ATGCTAACATACGACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
68.333 |
0.517 |