Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL27_RS02835 | Genome accession | NZ_LS483329 |
| Coordinates | 515895..516077 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12058 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 473050..516077 | 515895..516077 | within | 0 |
Gene organization within MGE regions
Location: 473050..516077
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL27_RS02555 (NCTC12058_00504) | - | 473068..473910 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| DQL27_RS02560 (NCTC12058_00505) | - | 473888..474475 (+) | 588 | WP_111711355.1 | YpmS family protein | - |
| DQL27_RS02565 (NCTC12058_00506) | - | 474574..474849 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL27_RS02570 (NCTC12058_00507) | - | 474939..476081 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL27_RS02575 (NCTC12058_00508) | - | 476210..476476 (-) | 267 | WP_076634078.1 | DUF4177 domain-containing protein | - |
| DQL27_RS02580 (NCTC12058_00509) | - | 476488..476868 (-) | 381 | WP_111711356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL27_RS02585 (NCTC12058_00510) | - | 476872..477219 (-) | 348 | WP_111688316.1 | helix-turn-helix domain-containing protein | - |
| DQL27_RS02590 | - | 477641..477736 (-) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| DQL27_RS02595 (NCTC12058_00512) | - | 478372..478563 (+) | 192 | WP_002993390.1 | hypothetical protein | - |
| DQL27_RS02600 (NCTC12058_00513) | - | 478575..479228 (+) | 654 | WP_111688314.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL27_RS02605 (NCTC12058_00515) | - | 479327..479587 (-) | 261 | WP_023611024.1 | hypothetical protein | - |
| DQL27_RS02610 (NCTC12058_00516) | - | 479729..479938 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| DQL27_RS02615 (NCTC12058_00517) | - | 480018..480266 (+) | 249 | WP_023611035.1 | hypothetical protein | - |
| DQL27_RS02620 (NCTC12058_00518) | - | 480240..480455 (-) | 216 | WP_023611028.1 | hypothetical protein | - |
| DQL27_RS02625 (NCTC12058_00519) | - | 480562..480873 (+) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQL27_RS02630 (NCTC12058_00520) | - | 480875..481045 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQL27_RS09240 (NCTC12058_00521) | - | 481038..481254 (+) | 217 | Protein_460 | hypothetical protein | - |
| DQL27_RS02640 (NCTC12058_00522) | - | 481251..481637 (+) | 387 | WP_111694890.1 | hypothetical protein | - |
| DQL27_RS02645 (NCTC12058_00524) | - | 482127..482330 (+) | 204 | WP_023611025.1 | hypothetical protein | - |
| DQL27_RS02650 (NCTC12058_00525) | - | 482419..482718 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| DQL27_RS02655 (NCTC12058_00526) | - | 482718..483875 (+) | 1158 | WP_023611034.1 | DUF2800 domain-containing protein | - |
| DQL27_RS02660 (NCTC12058_00527) | - | 483884..484447 (+) | 564 | WP_111674646.1 | DUF2815 family protein | - |
| DQL27_RS02665 (NCTC12058_00528) | - | 484490..486412 (+) | 1923 | WP_111674645.1 | DNA polymerase | - |
| DQL27_RS02670 (NCTC12058_00529) | - | 486417..488801 (+) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| DQL27_RS02675 (NCTC12058_00530) | - | 489187..489462 (+) | 276 | WP_050320439.1 | VRR-NUC domain-containing protein | - |
| DQL27_RS02680 (NCTC12058_00531) | - | 489459..490781 (+) | 1323 | WP_111694889.1 | SNF2-related protein | - |
| DQL27_RS09010 (NCTC12058_00532) | - | 490782..490952 (+) | 171 | WP_164972002.1 | hypothetical protein | - |
| DQL27_RS02685 (NCTC12058_00533) | - | 490945..491217 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQL27_RS02690 (NCTC12058_00535) | - | 491350..491766 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQL27_RS02695 (NCTC12058_00536) | terS | 491886..492581 (+) | 696 | WP_050318691.1 | phage terminase small subunit | - |
| DQL27_RS02700 (NCTC12058_00537) | - | 492574..493869 (+) | 1296 | WP_165363098.1 | PBSX family phage terminase large subunit | - |
| DQL27_RS02705 (NCTC12058_00538) | - | 493883..495385 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| DQL27_RS02710 (NCTC12058_00539) | - | 495390..496868 (+) | 1479 | WP_111694888.1 | phage minor capsid protein | - |
| DQL27_RS02715 (NCTC12058_00540) | - | 496840..497079 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DQL27_RS02720 (NCTC12058_00541) | - | 497141..497407 (+) | 267 | WP_111694887.1 | hypothetical protein | - |
| DQL27_RS02725 (NCTC12058_00542) | - | 497533..498147 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| DQL27_RS02730 (NCTC12058_00543) | - | 498151..498969 (+) | 819 | WP_111711357.1 | N4-gp56 family major capsid protein | - |
| DQL27_RS02735 (NCTC12058_00544) | - | 499023..499439 (+) | 417 | WP_111694886.1 | hypothetical protein | - |
| DQL27_RS02740 (NCTC12058_00545) | - | 499429..499761 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| DQL27_RS02745 (NCTC12058_00546) | - | 499761..500117 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DQL27_RS02750 (NCTC12058_00547) | - | 500114..500512 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DQL27_RS02755 (NCTC12058_00548) | - | 500512..500982 (+) | 471 | WP_011527917.1 | phage tail tube protein | - |
| DQL27_RS02760 (NCTC12058_00549) | - | 501035..501469 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| DQL27_RS02765 (NCTC12058_00550) | - | 501473..502054 (+) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| DQL27_RS02770 (NCTC12058_00551) | - | 502044..505304 (+) | 3261 | WP_111711358.1 | tape measure protein | - |
| DQL27_RS02775 (NCTC12058_00552) | - | 505301..506017 (+) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| DQL27_RS02780 (NCTC12058_00553) | - | 506014..508161 (+) | 2148 | WP_111694884.1 | phage tail spike protein | - |
| DQL27_RS02785 (NCTC12058_00554) | - | 508158..509381 (+) | 1224 | WP_030127718.1 | hypothetical protein | - |
| DQL27_RS02790 (NCTC12058_00555) | - | 509383..509697 (+) | 315 | WP_063812987.1 | hypothetical protein | - |
| DQL27_RS02795 (NCTC12058_00556) | - | 509708..511531 (+) | 1824 | WP_111711359.1 | gp58-like family protein | - |
| DQL27_RS02800 (NCTC12058_00557) | - | 511540..511968 (+) | 429 | WP_111694882.1 | DUF1617 family protein | - |
| DQL27_RS02805 (NCTC12058_00558) | - | 511971..512582 (+) | 612 | WP_111694881.1 | DUF1366 domain-containing protein | - |
| DQL27_RS02810 (NCTC12058_00559) | - | 512593..512922 (+) | 330 | WP_111694880.1 | hypothetical protein | - |
| DQL27_RS02815 (NCTC12058_00560) | - | 512924..513256 (+) | 333 | WP_003052353.1 | phage holin | - |
| DQL27_RS02820 (NCTC12058_00561) | - | 513258..514010 (+) | 753 | WP_023611694.1 | CHAP domain-containing protein | - |
| DQL27_RS02825 (NCTC12058_00562) | speC | 514079..514786 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL27_RS02830 (NCTC12058_00563) | mf2 | 514897..515655 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DQL27_RS02835 (NCTC12058_00564) | prx | 515895..516077 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=1136798 DQL27_RS02835 WP_011184726.1 515895..516077(+) (prx) [Streptococcus pyogenes strain NCTC12058]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136798 DQL27_RS02835 WP_011184726.1 515895..516077(+) (prx) [Streptococcus pyogenes strain NCTC12058]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |