Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL47_RS04790 | Genome accession | NZ_LS483328 |
| Coordinates | 997630..997818 (+) | Length | 62 a.a. |
| NCBI ID | WP_043983595.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain NCTC12090 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 963912..999862 | 997630..997818 | within | 0 |
Gene organization within MGE regions
Location: 963912..999862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL47_RS04540 (NCTC12090_00906) | - | 963912..965000 (-) | 1089 | WP_050316838.1 | site-specific integrase | - |
| DQL47_RS04545 (NCTC12090_00907) | - | 965126..966199 (-) | 1074 | WP_111678835.1 | Abi family protein | - |
| DQL47_RS04550 (NCTC12090_00908) | - | 966401..967189 (-) | 789 | WP_111678015.1 | XRE family transcriptional regulator | - |
| DQL47_RS04555 (NCTC12090_00910) | - | 967464..968147 (-) | 684 | WP_043052997.1 | DUF4145 domain-containing protein | - |
| DQL47_RS04560 (NCTC12090_00911) | - | 968204..968395 (+) | 192 | WP_043983624.1 | helix-turn-helix transcriptional regulator | - |
| DQL47_RS04565 (NCTC12090_00912) | - | 968463..969188 (+) | 726 | WP_043983623.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL47_RS10490 (NCTC12090_00913) | - | 969201..969332 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| DQL47_RS04570 (NCTC12090_00914) | - | 969329..969511 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| DQL47_RS04575 (NCTC12090_00915) | - | 969618..969908 (+) | 291 | WP_043983622.1 | MerR family transcriptional regulator | - |
| DQL47_RS04580 (NCTC12090_00916) | - | 970054..970866 (+) | 813 | WP_050316935.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQL47_RS04585 (NCTC12090_00917) | - | 970853..971635 (+) | 783 | WP_043983621.1 | ATP-binding protein | - |
| DQL47_RS04590 (NCTC12090_00919) | - | 971772..971984 (+) | 213 | WP_043983620.1 | hypothetical protein | - |
| DQL47_RS04595 (NCTC12090_00920) | - | 972048..972437 (+) | 390 | WP_111678017.1 | YopX family protein | - |
| DQL47_RS04600 (NCTC12090_00921) | - | 972434..972778 (+) | 345 | WP_043983618.1 | VVA0879 family protein | - |
| DQL47_RS04605 (NCTC12090_00922) | - | 972775..972975 (+) | 201 | WP_043983617.1 | hypothetical protein | - |
| DQL47_RS04610 (NCTC12090_00923) | - | 972968..973195 (+) | 228 | WP_043983616.1 | membrane protein | - |
| DQL47_RS04615 (NCTC12090_00924) | - | 973199..973684 (+) | 486 | WP_043983615.1 | class I SAM-dependent methyltransferase | - |
| DQL47_RS04620 (NCTC12090_00925) | - | 973681..974439 (+) | 759 | WP_043983614.1 | DNA methyltransferase | - |
| DQL47_RS04625 (NCTC12090_00926) | - | 974436..974654 (+) | 219 | WP_043983613.1 | hypothetical protein | - |
| DQL47_RS04630 (NCTC12090_00927) | - | 974654..975085 (+) | 432 | WP_043983612.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL47_RS04635 (NCTC12090_00928) | - | 975223..975789 (+) | 567 | WP_111678019.1 | tyrosine-type recombinase/integrase | - |
| DQL47_RS04640 (NCTC12090_00929) | - | 975953..976291 (+) | 339 | WP_043983611.1 | HNH endonuclease | - |
| DQL47_RS04645 (NCTC12090_00930) | - | 976428..977690 (+) | 1263 | WP_043983610.1 | hypothetical protein | - |
| DQL47_RS04650 (NCTC12090_00931) | - | 977683..979080 (+) | 1398 | WP_111690079.1 | hypothetical protein | - |
| DQL47_RS04655 (NCTC12090_00932) | - | 979070..979363 (+) | 294 | WP_043983608.1 | hypothetical protein | - |
| DQL47_RS04660 (NCTC12090_00933) | - | 979417..979641 (+) | 225 | WP_043983607.1 | hypothetical protein | - |
| DQL47_RS04665 (NCTC12090_00934) | - | 979643..979900 (+) | 258 | WP_043983606.1 | DUF6275 family protein | - |
| DQL47_RS04670 (NCTC12090_00935) | - | 979993..981408 (+) | 1416 | WP_111690080.1 | terminase | - |
| DQL47_RS04675 (NCTC12090_00936) | - | 981483..981938 (+) | 456 | WP_037578498.1 | phage scaffold protein | - |
| DQL47_RS04680 (NCTC12090_00937) | - | 981942..982832 (+) | 891 | WP_043053013.1 | phage major capsid protein | - |
| DQL47_RS04685 (NCTC12090_00938) | - | 982835..983047 (+) | 213 | WP_043983605.1 | HeH/LEM domain-containing protein | - |
| DQL47_RS04690 (NCTC12090_00939) | - | 983098..983496 (+) | 399 | WP_111690081.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL47_RS04695 (NCTC12090_00940) | - | 983483..983821 (+) | 339 | WP_111690082.1 | hypothetical protein | - |
| DQL47_RS04700 (NCTC12090_00941) | - | 983814..984050 (+) | 237 | WP_043983604.1 | hypothetical protein | - |
| DQL47_RS04705 (NCTC12090_00942) | - | 984051..984386 (+) | 336 | WP_043053018.1 | hypothetical protein | - |
| DQL47_RS04710 (NCTC12090_00943) | - | 984403..984984 (+) | 582 | WP_043983603.1 | hypothetical protein | - |
| DQL47_RS04715 (NCTC12090_00944) | - | 984995..985258 (+) | 264 | WP_043983602.1 | hypothetical protein | - |
| DQL47_RS04720 (NCTC12090_00945) | - | 985273..985644 (+) | 372 | WP_111690084.1 | DUF5361 domain-containing protein | - |
| DQL47_RS04725 (NCTC12090_00946) | - | 985644..988004 (+) | 2361 | WP_043983600.1 | hypothetical protein | - |
| DQL47_RS04730 (NCTC12090_00947) | - | 988001..988696 (+) | 696 | WP_043983599.1 | hypothetical protein | - |
| DQL47_RS04735 (NCTC12090_00948) | - | 988693..990639 (+) | 1947 | WP_111678028.1 | phage tail spike protein | - |
| DQL47_RS04740 (NCTC12090_00949) | - | 990639..991322 (+) | 684 | WP_111690085.1 | collagen-like protein | - |
| DQL47_RS04745 (NCTC12090_00950) | - | 991324..991941 (+) | 618 | WP_043983598.1 | hypothetical protein | - |
| DQL47_RS04750 (NCTC12090_00951) | - | 991951..993816 (+) | 1866 | WP_043983597.1 | gp58-like family protein | - |
| DQL47_RS04755 (NCTC12090_00952) | - | 993830..994015 (+) | 186 | WP_111678031.1 | hypothetical protein | - |
| DQL47_RS04760 (NCTC12090_00953) | - | 994018..994632 (+) | 615 | WP_111678032.1 | DUF1366 domain-containing protein | - |
| DQL47_RS04765 (NCTC12090_00954) | - | 994643..995014 (+) | 372 | WP_012678881.1 | phage holin family protein | - |
| DQL47_RS04770 (NCTC12090_00956) | - | 995130..996326 (+) | 1197 | WP_043983596.1 | glucosaminidase domain-containing protein | - |
| DQL47_RS04780 (NCTC12090_00957) | - | 996707..997282 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| DQL47_RS04790 (NCTC12090_00959) | prx | 997630..997818 (+) | 189 | WP_043983595.1 | Paratox | Regulator |
| DQL47_RS04800 (NCTC12090_00961) | - | 998410..999021 (+) | 612 | WP_041785453.1 | TVP38/TMEM64 family protein | - |
| DQL47_RS04805 (NCTC12090_00962) | - | 999068..999862 (-) | 795 | WP_012515506.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7221.23 Da Isoelectric Point: 5.0079
>NTDB_id=1136741 DQL47_RS04790 WP_043983595.1 997630..997818(+) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC12090]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1136741 DQL47_RS04790 WP_043983595.1 997630..997818(+) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC12090]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |