Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL59_RS04540 | Genome accession | NZ_LS483326 |
| Coordinates | 895244..895426 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12045 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 895244..943133 | 895244..895426 | within | 0 |
Gene organization within MGE regions
Location: 895244..943133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL59_RS04540 (NCTC12045_00900) | prx | 895244..895426 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| DQL59_RS04550 (NCTC12045_00902) | - | 895772..896347 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| DQL59_RS04555 (NCTC12045_00903) | spek | 896823..897602 (-) | 780 | WP_038432391.1 | streptococcal pyrogenic exotoxin SpeK | - |
| DQL59_RS04560 (NCTC12045_00904) | - | 897987..898580 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| DQL59_RS04565 (NCTC12045_00905) | - | 898580..898744 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| DQL59_RS04570 (NCTC12045_00906) | - | 898893..899534 (-) | 642 | Protein_847 | CHAP domain-containing protein | - |
| DQL59_RS04575 (NCTC12045_00907) | - | 899647..900339 (-) | 693 | WP_111681172.1 | AP2 domain-containing protein | - |
| DQL59_RS04580 (NCTC12045_00908) | - | 900575..901129 (-) | 555 | Protein_849 | glycoside hydrolase family 73 protein | - |
| DQL59_RS04585 (NCTC12045_00910) | - | 901240..901425 (-) | 186 | WP_011054731.1 | holin | - |
| DQL59_RS04590 (NCTC12045_00911) | - | 901422..901718 (-) | 297 | WP_023078532.1 | hypothetical protein | - |
| DQL59_RS04595 (NCTC12045_00912) | - | 901715..902335 (-) | 621 | WP_111681173.1 | DUF1366 domain-containing protein | - |
| DQL59_RS04600 (NCTC12045_00913) | - | 902338..902766 (-) | 429 | WP_011018112.1 | DUF1617 family protein | - |
| DQL59_RS04605 (NCTC12045_00914) | - | 902778..904793 (-) | 2016 | WP_111681174.1 | gp58-like family protein | - |
| DQL59_RS04610 (NCTC12045_00915) | - | 904808..905812 (-) | 1005 | WP_032462882.1 | hyaluronoglucosaminidase | - |
| DQL59_RS04615 (NCTC12045_00916) | - | 905809..907860 (-) | 2052 | WP_111681175.1 | phage tail spike protein | - |
| DQL59_RS04620 (NCTC12045_00917) | - | 907857..908636 (-) | 780 | WP_111681176.1 | distal tail protein Dit | - |
| DQL59_RS04625 (NCTC12045_00918) | - | 908668..912303 (-) | 3636 | WP_111681177.1 | tape measure protein | - |
| DQL59_RS04630 (NCTC12045_00919) | - | 912318..912647 (-) | 330 | WP_111681178.1 | hypothetical protein | - |
| DQL59_RS04635 (NCTC12045_00920) | - | 912689..913048 (-) | 360 | WP_023605140.1 | tail assembly chaperone | - |
| DQL59_RS04640 (NCTC12045_00921) | - | 913108..913677 (-) | 570 | WP_080473792.1 | phage major tail protein, TP901-1 family | - |
| DQL59_RS04645 (NCTC12045_00922) | - | 913732..914121 (-) | 390 | WP_111681179.1 | phage capsid protein | - |
| DQL59_RS04650 (NCTC12045_00923) | - | 914118..914483 (-) | 366 | WP_111681180.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL59_RS04655 (NCTC12045_00924) | - | 914464..914772 (-) | 309 | WP_111681181.1 | hypothetical protein | - |
| DQL59_RS04660 (NCTC12045_00925) | - | 914769..915122 (-) | 354 | WP_111681182.1 | phage head-tail connector protein | - |
| DQL59_RS04665 (NCTC12045_00926) | - | 915136..915378 (-) | 243 | WP_111681183.1 | HeH/LEM domain-containing protein | - |
| DQL59_RS04670 (NCTC12045_00927) | - | 915388..916467 (-) | 1080 | WP_111681184.1 | major capsid protein | - |
| DQL59_RS04675 (NCTC12045_00928) | - | 916470..916850 (-) | 381 | WP_002990036.1 | structural protein | - |
| DQL59_RS04680 (NCTC12045_00929) | - | 916860..917393 (-) | 534 | WP_014635511.1 | DUF4355 domain-containing protein | - |
| DQL59_RS04685 (NCTC12045_00930) | - | 917537..917803 (-) | 267 | WP_032462876.1 | hypothetical protein | - |
| DQL59_RS04695 (NCTC12045_00931) | - | 918190..918375 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| DQL59_RS04700 (NCTC12045_00932) | - | 918379..919941 (-) | 1563 | WP_032462875.1 | phage head morphogenesis protein | - |
| DQL59_RS04705 (NCTC12045_00933) | - | 919922..921424 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| DQL59_RS04710 (NCTC12045_00934) | - | 921436..922743 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| DQL59_RS04715 (NCTC12045_00935) | - | 922721..923173 (-) | 453 | WP_032461951.1 | terminase small subunit | - |
| DQL59_RS04720 (NCTC12045_00936) | - | 923263..923679 (-) | 417 | WP_032461950.1 | DUF722 domain-containing protein | - |
| DQL59_RS04725 (NCTC12045_00937) | - | 923676..923867 (-) | 192 | WP_032461949.1 | hypothetical protein | - |
| DQL59_RS04730 (NCTC12045_00938) | - | 923959..924501 (-) | 543 | WP_111681185.1 | hypothetical protein | - |
| DQL59_RS04735 (NCTC12045_00939) | - | 924504..924770 (-) | 267 | WP_032461948.1 | hypothetical protein | - |
| DQL59_RS08925 (NCTC12045_00940) | - | 924767..924934 (-) | 168 | WP_023079219.1 | hypothetical protein | - |
| DQL59_RS04740 (NCTC12045_00941) | - | 924935..926257 (-) | 1323 | WP_111681186.1 | SNF2-related protein | - |
| DQL59_RS04745 (NCTC12045_00942) | - | 926254..926529 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DQL59_RS04750 (NCTC12045_00943) | - | 926915..929299 (-) | 2385 | WP_085613976.1 | phage/plasmid primase, P4 family | - |
| DQL59_RS04755 (NCTC12045_00944) | - | 929304..931226 (-) | 1923 | WP_032461903.1 | DNA polymerase | - |
| DQL59_RS04760 (NCTC12045_00945) | - | 931269..931832 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQL59_RS04765 (NCTC12045_00946) | - | 931841..932998 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQL59_RS04770 (NCTC12045_00947) | - | 932998..933297 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQL59_RS04775 (NCTC12045_00948) | - | 933385..933588 (-) | 204 | WP_111681187.1 | hypothetical protein | - |
| DQL59_RS04780 (NCTC12045_00950) | - | 933735..934120 (-) | 386 | Protein_889 | hypothetical protein | - |
| DQL59_RS04785 (NCTC12045_00951) | - | 934117..934320 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| DQL59_RS04790 (NCTC12045_00952) | - | 934313..934483 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQL59_RS04795 (NCTC12045_00953) | - | 934485..934796 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| DQL59_RS04800 | - | 934875..935060 (-) | 186 | WP_032461902.1 | helix-turn-helix domain-containing protein | - |
| DQL59_RS04805 (NCTC12045_00954) | - | 935203..935517 (+) | 315 | WP_032461901.1 | hypothetical protein | - |
| DQL59_RS04810 (NCTC12045_00955) | - | 935492..935842 (-) | 351 | WP_111681188.1 | hypothetical protein | - |
| DQL59_RS04815 (NCTC12045_00956) | - | 935899..936108 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| DQL59_RS04825 (NCTC12045_00958) | - | 936354..936560 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| DQL59_RS04830 (NCTC12045_00959) | - | 936634..937116 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| DQL59_RS08930 (NCTC12045_00960) | - | 937113..937259 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| DQL59_RS04835 (NCTC12045_00961) | - | 937314..937913 (+) | 600 | WP_111681189.1 | hypothetical protein | - |
| DQL59_RS04840 (NCTC12045_00962) | - | 937945..938103 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| DQL59_RS04845 (NCTC12045_00964) | - | 938493..939251 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| DQL59_RS04850 (NCTC12045_00965) | - | 939286..939966 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| DQL59_RS04855 (NCTC12045_00966) | - | 940103..941245 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL59_RS04860 (NCTC12045_00967) | - | 941334..941609 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL59_RS04865 (NCTC12045_00968) | - | 941708..942295 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| DQL59_RS04870 (NCTC12045_00969) | - | 942273..943115 (-) | 843 | WP_172449685.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=1136624 DQL59_RS04540 WP_011017964.1 895244..895426(-) (prx) [Streptococcus pyogenes strain NCTC12045]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136624 DQL59_RS04540 WP_011017964.1 895244..895426(-) (prx) [Streptococcus pyogenes strain NCTC12045]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |