Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL35_RS04660 | Genome accession | NZ_LS483325 |
| Coordinates | 965430..965618 (+) | Length | 62 a.a. |
| NCBI ID | WP_043983595.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain NCTC7022 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 931719..980186 | 965430..965618 | within | 0 |
Gene organization within MGE regions
Location: 931719..980186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL35_RS04410 (NCTC7022_00877) | - | 931719..932807 (-) | 1089 | WP_050316838.1 | site-specific integrase | - |
| DQL35_RS04415 (NCTC7022_00878) | - | 932933..934006 (-) | 1074 | WP_111678835.1 | Abi family protein | - |
| DQL35_RS04420 (NCTC7022_00879) | - | 934208..934996 (-) | 789 | WP_111678015.1 | XRE family transcriptional regulator | - |
| DQL35_RS04425 (NCTC7022_00881) | - | 935271..935954 (-) | 684 | WP_043052997.1 | DUF4145 domain-containing protein | - |
| DQL35_RS04430 (NCTC7022_00882) | - | 936011..936202 (+) | 192 | WP_043983624.1 | helix-turn-helix transcriptional regulator | - |
| DQL35_RS04435 (NCTC7022_00883) | - | 936270..936995 (+) | 726 | WP_043983623.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL35_RS10935 (NCTC7022_00884) | - | 937008..937139 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| DQL35_RS04440 (NCTC7022_00885) | - | 937136..937318 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| DQL35_RS04445 (NCTC7022_00886) | - | 937425..937715 (+) | 291 | WP_043983622.1 | MerR family transcriptional regulator | - |
| DQL35_RS04450 (NCTC7022_00887) | - | 937861..938667 (+) | 807 | WP_111678016.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQL35_RS04455 (NCTC7022_00888) | - | 938654..939436 (+) | 783 | WP_043983621.1 | ATP-binding protein | - |
| DQL35_RS04460 (NCTC7022_00890) | - | 939573..939785 (+) | 213 | WP_043983620.1 | hypothetical protein | - |
| DQL35_RS04465 (NCTC7022_00891) | - | 939849..940238 (+) | 390 | WP_111678017.1 | YopX family protein | - |
| DQL35_RS04470 (NCTC7022_00892) | - | 940235..940579 (+) | 345 | WP_043983618.1 | VVA0879 family protein | - |
| DQL35_RS04475 (NCTC7022_00893) | - | 940576..940776 (+) | 201 | WP_043983617.1 | hypothetical protein | - |
| DQL35_RS04480 (NCTC7022_00894) | - | 940769..940996 (+) | 228 | WP_043983616.1 | membrane protein | - |
| DQL35_RS04485 (NCTC7022_00895) | - | 941000..941485 (+) | 486 | WP_043983615.1 | class I SAM-dependent methyltransferase | - |
| DQL35_RS04490 (NCTC7022_00896) | - | 941482..942240 (+) | 759 | WP_111678018.1 | DNA methyltransferase | - |
| DQL35_RS04495 (NCTC7022_00897) | - | 942237..942455 (+) | 219 | WP_043983613.1 | hypothetical protein | - |
| DQL35_RS04500 (NCTC7022_00898) | - | 942455..942886 (+) | 432 | WP_043983612.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL35_RS04505 (NCTC7022_00899) | - | 943024..943590 (+) | 567 | WP_111678019.1 | tyrosine-type recombinase/integrase | - |
| DQL35_RS04510 (NCTC7022_00900) | - | 943754..944092 (+) | 339 | WP_043983611.1 | HNH endonuclease | - |
| DQL35_RS04515 (NCTC7022_00901) | - | 944229..945491 (+) | 1263 | WP_037578510.1 | hypothetical protein | - |
| DQL35_RS04520 (NCTC7022_00902) | - | 945484..946881 (+) | 1398 | WP_037578508.1 | hypothetical protein | - |
| DQL35_RS04525 (NCTC7022_00903) | - | 946871..947164 (+) | 294 | WP_111678020.1 | hypothetical protein | - |
| DQL35_RS04530 (NCTC7022_00904) | - | 947218..947442 (+) | 225 | WP_043983607.1 | hypothetical protein | - |
| DQL35_RS04535 (NCTC7022_00905) | - | 947444..947701 (+) | 258 | WP_043983606.1 | DUF6275 family protein | - |
| DQL35_RS04540 (NCTC7022_00906) | - | 947794..949209 (+) | 1416 | WP_111678021.1 | terminase | - |
| DQL35_RS04545 (NCTC7022_00907) | - | 949284..949739 (+) | 456 | WP_037578498.1 | phage scaffold protein | - |
| DQL35_RS04550 (NCTC7022_00908) | - | 949743..950633 (+) | 891 | WP_111678022.1 | phage major capsid protein | - |
| DQL35_RS04555 (NCTC7022_00909) | - | 950636..950848 (+) | 213 | WP_043983605.1 | HeH/LEM domain-containing protein | - |
| DQL35_RS04560 (NCTC7022_00910) | - | 950899..951297 (+) | 399 | WP_111678023.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL35_RS04565 (NCTC7022_00911) | - | 951284..951622 (+) | 339 | WP_111678024.1 | hypothetical protein | - |
| DQL35_RS04570 (NCTC7022_00912) | - | 951615..951851 (+) | 237 | WP_111678025.1 | hypothetical protein | - |
| DQL35_RS04575 (NCTC7022_00913) | - | 951852..952187 (+) | 336 | WP_043053018.1 | hypothetical protein | - |
| DQL35_RS04580 (NCTC7022_00914) | - | 952204..952785 (+) | 582 | WP_172452928.1 | phage tail protein | - |
| DQL35_RS04585 (NCTC7022_00915) | - | 952796..953059 (+) | 264 | WP_111678027.1 | hypothetical protein | - |
| DQL35_RS04590 (NCTC7022_00916) | - | 953074..953445 (+) | 372 | WP_037578477.1 | DUF5361 domain-containing protein | - |
| DQL35_RS04595 (NCTC7022_00917) | - | 953445..955805 (+) | 2361 | WP_043983600.1 | hypothetical protein | - |
| DQL35_RS04600 (NCTC7022_00918) | - | 955802..956497 (+) | 696 | WP_043983599.1 | hypothetical protein | - |
| DQL35_RS04605 (NCTC7022_00919) | - | 956494..958440 (+) | 1947 | WP_111678028.1 | phage tail spike protein | - |
| DQL35_RS04610 (NCTC7022_00920) | - | 958440..959123 (+) | 684 | WP_111678029.1 | collagen-like protein | - |
| DQL35_RS04615 (NCTC7022_00921) | - | 959125..959742 (+) | 618 | WP_111678030.1 | hypothetical protein | - |
| DQL35_RS04620 (NCTC7022_00922) | - | 959752..961617 (+) | 1866 | WP_043983597.1 | gp58-like family protein | - |
| DQL35_RS04625 (NCTC7022_00923) | - | 961631..961816 (+) | 186 | WP_111678031.1 | hypothetical protein | - |
| DQL35_RS04630 (NCTC7022_00924) | - | 961819..962433 (+) | 615 | WP_111678032.1 | DUF1366 domain-containing protein | - |
| DQL35_RS04635 (NCTC7022_00925) | - | 962444..962815 (+) | 372 | WP_012678881.1 | phage holin family protein | - |
| DQL35_RS04640 (NCTC7022_00927) | - | 962931..964127 (+) | 1197 | WP_043983596.1 | glucosaminidase domain-containing protein | - |
| DQL35_RS04650 (NCTC7022_00928) | - | 964507..965082 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| DQL35_RS04660 (NCTC7022_00930) | prx | 965430..965618 (+) | 189 | WP_043983595.1 | Paratox | Regulator |
| DQL35_RS04670 (NCTC7022_00932) | - | 966213..966824 (+) | 612 | WP_041785453.1 | TVP38/TMEM64 family protein | - |
| DQL35_RS04675 (NCTC7022_00933) | - | 966871..967665 (-) | 795 | WP_111678034.1 | ABC transporter permease | - |
| DQL35_RS04680 (NCTC7022_00934) | - | 967675..968373 (-) | 699 | WP_111678035.1 | ABC transporter ATP-binding protein | - |
| DQL35_RS04685 (NCTC7022_00935) | - | 968373..968744 (-) | 372 | WP_012515508.1 | GntR family transcriptional regulator | - |
| DQL35_RS04690 (NCTC7022_00936) | - | 968987..972097 (+) | 3111 | WP_111678036.1 | DNA polymerase III subunit alpha | - |
| DQL35_RS04695 (NCTC7022_00937) | pfkA | 972177..973190 (+) | 1014 | WP_037578437.1 | 6-phosphofructokinase | - |
| DQL35_RS04700 (NCTC7022_00938) | pyk | 973252..974754 (+) | 1503 | WP_012515511.1 | pyruvate kinase | - |
| DQL35_RS04705 (NCTC7022_00939) | lepB | 974883..975440 (+) | 558 | WP_111678037.1 | signal peptidase I | - |
| DQL35_RS04710 (NCTC7022_00940) | glmS | 975617..977428 (+) | 1812 | WP_111678038.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| DQL35_RS04715 (NCTC7022_00941) | - | 977611..977946 (+) | 336 | WP_111678039.1 | zinc ribbon domain-containing protein YjdM | - |
| DQL35_RS04720 (NCTC7022_00942) | - | 978053..978694 (+) | 642 | WP_012678041.1 | amino acid ABC transporter permease | - |
| DQL35_RS04725 (NCTC7022_00943) | - | 978704..979333 (+) | 630 | WP_012515516.1 | amino acid ABC transporter ATP-binding protein | - |
| DQL35_RS04730 (NCTC7022_00944) | - | 979350..980186 (+) | 837 | WP_111678040.1 | amino acid ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7221.23 Da Isoelectric Point: 5.0079
>NTDB_id=1136571 DQL35_RS04660 WP_043983595.1 965430..965618(+) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC7022]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1136571 DQL35_RS04660 WP_043983595.1 965430..965618(+) (prx) [Streptococcus equi subsp. zooepidemicus strain NCTC7022]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |